Reaction Details |
| Report a problem with these data |
Target | NF-kappa-B inhibitor alpha |
---|
Ligand | BDBM50069985 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_465171 (CHEMBL945841) |
---|
EC50 | 5200±n/a nM |
---|
Citation | Xie, Y; Deng, S; Thomas, CJ; Liu, Y; Zhang, YQ; Rinderspacher, A; Huang, W; Gong, G; Wyler, M; Cayanis, E; Aulner, N; Többen, U; Chung, C; Pampou, S; Southall, N; Vidovic, D; Schürer, S; Branden, L; Davis, RE; Staudt, LM; Inglese, J; Austin, CP; Landry, DW; Smith, DH; Auld, DS Identification of N-(quinolin-8-yl)benzenesulfonamides as agents capable of down-regulating NFkappaB activity within two separate high-throughput screens of NFkappaB activation. Bioorg Med Chem Lett18:329-35 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
NF-kappa-B inhibitor alpha |
---|
Name: | NF-kappa-B inhibitor alpha |
Synonyms: | I-kappa-B-alpha | IKBA | IKBA_HUMAN | MAD3 | NF-kappa-B inhibitor alpha | NFKBI | NFKBIA |
Type: | GST fusion protein |
Mol. Mass.: | 35584.84 |
Organism: | Homo sapiens (Human) |
Description: | It was produced in E. coli as GST-tagged fusion protein (Santa Cruz Biotechnology). |
Residue: | 317 |
Sequence: | MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVP
RGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATN
YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTE
DELPYDDCVFGGQRLTL
|
|
|
BDBM50069985 |
---|
n/a |
---|
Name | BDBM50069985 |
Synonyms: | (S)-4-methyl-2-(3-phenyl-propionylamino)-pentanoic acid [(S)-1-((S)-1-formyl-3-methyl-butylcarbamoyl)-3-methyl-butyl]-amide | CHEMBL64925 | Cbz-L-leu-L-leu-L-leu-CHO | MG-13 | MG-132 | Z-L-leu-L-leu-L-leu-H | Z-Leu-Leu-Leu-H | Z-Leu-Leu-Leu-al | benzyl (S)-4-methyl-1-((S)-4-methyl-1-((S)-4-methyl-1-oxopentan-2-ylamino)-1-oxopentan-2-ylamino)-1-oxopentan-2-ylcarbamate | benzyl(S)-4-methyl-1-((S)-4-methyl-1-((S)-4-methyl-1-oxopentan-2-ylamino)-1-oxopentan-2-ylamino)-1-oxopentan-2-ylcarbamate | benzyloxycarbonyl-Leu-Leu-leucinal | {(S)-1-[(S)-1-((S)-1-Formyl-3-methyl-butylcarbamoyl)-3-methyl-butylcarbamoyl]-3-methyl-butyl}-carbamic acid benzyl ester | {1-[(S)-(S)-1-((S)-1-Formyl-3-methyl-butylcarbamoyl)-3-methyl-butylcarbamoyl]-3-methyl-butyl}-carbamic acid benzyl ester | {1-[1-(1-Formyl-3-methyl-butylcarbamoyl)-3-methyl-butylcarbamoyl]-3-methyl-butyl}-carbamic acid benzyl ester |
Type | Small organic molecule |
Emp. Form. | C26H41N3O5 |
Mol. Mass. | 475.6208 |
SMILES | CC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)OCc1ccccc1)C=O |r| |
Structure |
|