| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Aldo-keto reductase family 1 member B1 |
|---|
| Ligand | BDBM7459 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_533382 (CHEMBL980608) |
|---|
| IC50 | 1540±n/a nM |
|---|
| Citation |  Yoo, NH; Jang, DS; Yoo, JL; Lee, YM; Kim, YS; Cho, JH; Kim, JS Erigeroflavanone, a flavanone derivative from the flowers of Erigeron annuus with protein glycation and aldose reductase inhibitory activity. J Nat Prod71:713-5 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Aldo-keto reductase family 1 member B1 |
|---|
| Name: | Aldo-keto reductase family 1 member B1 |
|---|
| Synonyms: | ALDR_RAT | Akr1b1 | Akr1b4 | Aldose reductase | Aldr1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 35797.87 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_1512484 |
|---|
| Residue: | 316 |
|---|
| Sequence: | MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQ
EKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGP
DYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKP
AVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAK
YNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCA
LMSCAKHKDYPFHAEV
|
|
|
|---|
| BDBM7459 |
|---|
| n/a |
|---|
| Name | BDBM7459 |
|---|
| Synonyms: | 2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4H-chromen-4-one | 2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-chromen-4-one | CHEMBL151 | Luteolin (27) | Luteolin (4) | acs.jmedchem.1c00409_ST.600 | cid_5280445 | luteolin | med.21724, Compound 3 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H10O6 |
|---|
| Mol. Mass. | 286.2363 |
|---|
| SMILES | Oc1cc(O)c2c(c1)oc(cc2=O)-c1ccc(O)c(O)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
