Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSodium/glucose cotransporter 2 (SGLT2)
LigandBDBM50302605
Substrate/Competitorn/a
Meas. Tech.ChEMBL_594780
IC50 590±n/a nM
Citation Goodwin NCMabon RHarrison BAShadoan MKAlmstead ZYXie YHealy JBuhring LMDaCosta CMBardenhagen JMseeh FLiu QNouraldeen AWilson AGKimball SDPowell DRRawlins DB Novel L-xylose derivatives as selective sodium-dependent glucose cotransporter 2 (SGLT2) inhibitors for the treatment of type 2 diabetes. J Med Chem 52:6201-4 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sodium/glucose cotransporter 2 (SGLT2)
Name:Sodium/glucose cotransporter 2 (SGLT2)
Synonyms:Na(+)/glucose cotransporter 2 | Sodium-Dependent Glucose Cotransporter 2 (SGLT2) | Sodium-dependent glucose cotransporter 2 (SGLT2) | Sodium/glucose cotransporter 1 (SGLT1) | Sodium/glucose cotransporter 2 | Solute carrier family 5 member 2
Type:Protein
Mol. Mass.:72902.00
Organism:Homo sapiens (Human)
Description:P31639
Residue:672
Sequence:
MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGR
SMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNALFVVLLLGWLFAPVYLTA
GVITMPQYLRKRFGGRRIRLYLSVLSLFLYIFTKISVDMFSGAVFIQQALGWNIYASVIA
LLGITMIYTVTGGLAALMYTDTVQTFVILGGACILMGYAFHEVGGYSGLFDKYLGAATSL
TVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWPALLLGLTIVSGWYWCSDQVIVQR
CLAGKSLTHIKAGCILCGYLKLTPMFLMVMPGMISRILYPDEVACVVPEVCRRVCGTEVG
CSNIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDR
ELLLVGRLWVVFIVVVSVAWLPVVQAAQGGQLFDYIQAVSSYLAPPVSAVFVLALFVPRV
NEQGAFWGLIGGLLMGLARLIPEFSFGSGSCVQPSACPAFLCGVHYLYFAIVLFFCSGLL
TLTVSLCTAPIPRKHLHRLVFSLRHSKEEREDLDADEQQGSSLPVQNGCPESAMEMNEPQ
APAPSLFRQCLLWFCGMSRGGVGSPPPLTQEEAAAAARRLEDISEDPSWARVVNLNALLM
MAVAVFLWGFYA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50302605
n/a
NameBDBM50302605
Synonyms:(2S,3R,4R,5S)-2-(4-Chloro-3-(4-ethoxybenzyl)phenyl)-6-methoxy-2-methyltetrahydro-2Hpyran-3,4,5-triol | CHEMBL583016
TypeSmall organic molecule
Emp. Form.C22H27ClO6
Mol. Mass.422.899
SMILESCCOc1ccc(Cc2cc(ccc2Cl)[C@]2(C)OC(OC)[C@@H](O)[C@H](O)[C@H]2O)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: