Reaction Details |
| Report a problem with these data |
Target | Free fatty acid receptor 1 |
---|
Ligand | BDBM50382539 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_816332 (CHEMBL2027154) |
---|
Ki | 100±n/a nM |
---|
Citation | Negoro, N; Sasaki, S; Ito, M; Kitamura, S; Tsujihata, Y; Ito, R; Suzuki, M; Takeuchi, K; Suzuki, N; Miyazaki, J; Santou, T; Odani, T; Kanzaki, N; Funami, M; Tanaka, T; Yasuma, T; Momose, Y Identification of fused-ring alkanoic acids with improved pharmacokinetic profiles that act as G protein-coupled receptor 40/free fatty acid receptor 1 agonists. J Med Chem55:1538-52 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Free fatty acid receptor 1 |
---|
Name: | Free fatty acid receptor 1 |
Synonyms: | FFAR1_RAT | Ffar1 | G-protein coupled receptor 40 | Gpr40 |
Type: | PROTEIN |
Mol. Mass.: | 31848.38 |
Organism: | Rattus norvegicus |
Description: | ChEMBL_1511162 |
Residue: | 300 |
Sequence: | MDLPPQLSFALYVSAFALGFPLNLLAIRGAVSHAKLRLTPSLVYTLHLACSDLLLAITLP
LKAVEALASGVWPLPLPFCPVFALAHFAPLYAGGGFLAALSAGRYLGAAFPFGYQAIRRP
CYSWGVCVAIWALVLCHLGLALGLEAPRGWVDNTTSSLGINIPVNGSPVCLEAWDPDSAR
PARLSFSILLFFLPLVITAFCYVGCLRALVHSGLSHKRKLRAAWVAGGALLTLLLCLGPY
NASNVASFINPDLEGSWRKLGLITGAWSVVLNPLVTGYLGTGPGQGTICVTRTPRGTIQK
|
|
|
BDBM50382539 |
---|
n/a |
---|
Name | BDBM50382539 |
Synonyms: | CHEMBL2022576 |
Type | Small organic molecule |
Emp. Form. | C32H30O5 |
Mol. Mass. | 494.5776 |
SMILES | Cc1cc(OCc2ccccc2)cc(C)c1-c1cccc(COc2ccc3C(CC(O)=O)COc3c2)c1 |
Structure |
|