Reaction Details |
| Report a problem with these data |
Target | Arachidonate 5-lipoxygenase-activating protein |
---|
Ligand | BDBM50385340 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_822749 (CHEMBL2040233) |
---|
IC50 | 980±n/a nM |
---|
Citation | Banoglu, E; Çaliskan, B; Luderer, S; Eren, G; Özkan, Y; Altenhofen, W; Weinigel, C; Barz, D; Gerstmeier, J; Pergola, C; Werz, O Identification of novel benzimidazole derivatives as inhibitors of leukotriene biosynthesis by virtual screening targeting 5-lipoxygenase-activating protein (FLAP). Bioorg Med Chem20:3728-41 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Arachidonate 5-lipoxygenase-activating protein |
---|
Name: | Arachidonate 5-lipoxygenase-activating protein |
Synonyms: | 5-lipoxygenase activating protein | 5-lipoxygenase-activating protein (FLAP) | 5-lipoxygenase/FLAP | AL5AP_HUMAN | ALOX5AP | FLAP | MK-886-binding protein |
Type: | Enzyme |
Mol. Mass.: | 18159.90 |
Organism: | Homo sapiens (Human) |
Description: | P20292 |
Residue: | 161 |
Sequence: | MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC
VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL
FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
|
|
|
BDBM50385340 |
---|
n/a |
---|
Name | BDBM50385340 |
Synonyms: | CHEMBL2036165 |
Type | Small organic molecule |
Emp. Form. | C26H28N2 |
Mol. Mass. | 368.5139 |
SMILES | CC(C)Cc1ccc(cc1)C(C)c1nc2ccccc2n1Cc1ccccc1 |
Structure |
|