| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Free fatty acid receptor 1 |
|---|
| Ligand | BDBM50386653 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_826836 (CHEMBL2051553) |
|---|
| Ki | 10000±n/a nM |
|---|
| Citation |  Mikami, S; Kitamura, S; Negoro, N; Sasaki, S; Suzuki, M; Tsujihata, Y; Miyazaki, T; Ito, R; Suzuki, N; Miyazaki, J; Santou, T; Kanzaki, N; Funami, M; Tanaka, T; Yasuma, T; Momose, Y Discovery of phenylpropanoic acid derivatives containing polar functionalities as potent and orally bioavailable G protein-coupled receptor 40 agonists for the treatment of type 2 diabetes. J Med Chem55:3756-76 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Free fatty acid receptor 1 |
|---|
| Name: | Free fatty acid receptor 1 |
|---|
| Synonyms: | FFAR1_RAT | Ffar1 | G-protein coupled receptor 40 | Gpr40 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 31848.38 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_1511162 |
|---|
| Residue: | 300 |
|---|
| Sequence: | MDLPPQLSFALYVSAFALGFPLNLLAIRGAVSHAKLRLTPSLVYTLHLACSDLLLAITLP
LKAVEALASGVWPLPLPFCPVFALAHFAPLYAGGGFLAALSAGRYLGAAFPFGYQAIRRP
CYSWGVCVAIWALVLCHLGLALGLEAPRGWVDNTTSSLGINIPVNGSPVCLEAWDPDSAR
PARLSFSILLFFLPLVITAFCYVGCLRALVHSGLSHKRKLRAAWVAGGALLTLLLCLGPY
NASNVASFINPDLEGSWRKLGLITGAWSVVLNPLVTGYLGTGPGQGTICVTRTPRGTIQK
|
|
|
|---|
| BDBM50386653 |
|---|
| n/a |
|---|
| Name | BDBM50386653 |
|---|
| Synonyms: | CHEMBL2048611 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H26O4 |
|---|
| Mol. Mass. | 390.4715 |
|---|
| SMILES | COc1ccc(cc1COc1ccc(CCC(O)=O)cc1)-c1c(C)cccc1C |
|---|
| Structure | 
|
|---|
Search and Browse
