| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 4,4'-diapophytoene synthase |
|---|
| Ligand | BDBM50388906 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_830992 (CHEMBL2065644) |
|---|
| Ki | 450±n/a nM |
|---|
| Citation |  Zhang, Y; Fu-Yang, Lin; Li, K; Zhu, W; Liu, YL; Cao, R; Pang, R; Lee, E; Axelson, J; Hensler, M; Wang, K; Molohon, KJ; Wang, Y; Mitchell, DA; Nizet, V; Oldfield, E HIV-1 Integrase Inhibitor-Inspired Antibacterials Targeting Isoprenoid Biosynthesis. ACS Med Chem Lett3:402-406 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 4,4'-diapophytoene synthase |
|---|
| Name: | 4,4'-diapophytoene synthase |
|---|
| Synonyms: | CRTM_STAAU | Dehydrosqualene synthase | crtM |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 34309.10 |
|---|
| Organism: | Staphylococcus aureus |
|---|
| Description: | ChEMBL_1352846 |
|---|
| Residue: | 287 |
|---|
| Sequence: | MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFL
NQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMF
ETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENE
RIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPI
IELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKYHRI
|
|
|
|---|
| BDBM50388906 |
|---|
| n/a |
|---|
| Name | BDBM50388906 |
|---|
| Synonyms: | CHEMBL2063256 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H23NO5 |
|---|
| Mol. Mass. | 345.3896 |
|---|
| SMILES | CCCCCCOc1cccc(Cn2ccc(O)c(C(O)=O)c2=O)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
