Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificity protein kinase TTK
LigandBDBM50396148
Substrate/Competitorn/a
Meas. Tech.ChEMBL_874756
Ki 25±n/a nM
Citation Estrada AALiu XBaker-Glenn CBeresford ABurdick DJChambers MChan BKChen HDing XDiPasquale AGDominguez SLDotson JDrummond JFlagella MFlynn SFuji RGill AGunzner-Toste JHarris SFHeffron TPKleinheinz TLee DWLe Pichon CELyssikatos JPMedhurst ADMoffat JGMukund SNash KScearce-Levie KSheng ZShore DGTran TTrivedi NWang SZhang SZhang XZhao GZhu HSweeney ZK Discovery of highly potent, selective, and brain-penetrable leucine-rich repeat kinase 2 (LRRK2) small molecule inhibitors. J Med Chem 55:9416-33 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual specificity protein kinase TTK
Name:Dual specificity protein kinase TTK
Synonyms:Dual specificity protein kinase (TTK) | Dual specificity protein kinase TTK (MPS1) | MPS1 | Monopolar Spindle 1 (MPS1) | Monopolar Spindle 1 (Mps-1) | Monopolar Spindle 1 Kinase (MPS1) | Phosphotyrosine picked threonine-protein kinase (MPS1) | TTK
Type:Protein
Mol. Mass.:97086.79
Organism:Homo sapiens (Human)
Description:P33981
Residue:857
Sequence:
MESEDLSGRELTIDSIMNKVRDIKNKFKNEDLTDELSLNKISADTTDNSGTVNQIMMMAN
NPEDWLSLLLKLEKNSVPLSDALLNKLIGRYSQAIEALPPDKYGQNESFARIQVRFAELK
AIQEPDDARDYFQMARANCKKFAFVHISFAQFELSQGNVKKSKQLLQKAVERGAVPLEML
EIALRNLNLQKKQLLSEEEKKNLSASTVLTAQESFSGSLGHLQNRNNSCDSRGQTTKARF
LYGENMPPQDAEIGYRNSLRQTNKTKQSCPFGRVPVNLLNSPDCDVKTDDSVVPCFMKRQ
TSRSECRDLVVPGSKPSGNDSCELRNLKSVQNSHFKEPLVSDEKSSELIITDSITLKNKT
ESSLLAKLEETKEYQEPEVPESNQKQWQSKRKSECINQNPAASSNHWQIPELARKVNTEQ
KHTTFEQPVFSVSKQSPPISTSKWFDPKSICKTPSSNTLDDYMSCFRTPVVKNDFPPACQ
LSTPYGQPACFQQQQHQILATPLQNLQVLASSSANECISVKGRIYSILKQIGSGGSSKVF
QVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYM
VMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGML
KLIDFGIANQMQPDTTSVVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSL
GCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRI
SIPELLAHPYVQIQTHPVNQMAKGTTEEMKYVLGQLVGLNSPNSILKAAKTLYEHYSGGE
SHNSSSSKTFEKKRGKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50396148
n/a
NameBDBM50396148
Synonyms:CHEMBL2171745 | US8802674, 50
TypeSmall organic molecule
Emp. Form.C18H20F3N5O3
Mol. Mass.411.3783
SMILESCNc1nc(Nc2ccc(cc2OC)C(=O)N2CCOCC2)ncc1C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: