Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistidine-rich protein
LigandBDBM50015214
Substrate/Competitorn/a
Meas. Tech.ChEMBL_426926
IC50 292000±n/a nM
Citation Huy NTUyen DTMaeda ATrang DTOida THarada SKamei K Simple colorimetric inhibition assay of heme crystallization for high-throughput screening of antimalarial compounds. Antimicrob Agents Chemother 51:350-3 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histidine-rich protein
Name:Histidine-rich protein
Synonyms:Histidine-rich protein PFHRP-II
Type:PROTEIN
Mol. Mass.:35156.49
Organism:Plasmodium falciparum
Description:ChEMBL_500704
Residue:332
Sequence:
MVSFSKNKVLSAAVFASVLLLDNNNSAFNNNLCSKNAKGLNLNKRLLHETQAHVDDAHHA
HHVADAHHAHHAHHAADAHHAHHAADAHHAHHAADAHHAHHAADAHHAHHAADAHHAHHA
ADAHHAHHAADAHHAHHAADAHHAHHAADAHHAHHAAYAHHAHHASDAHHAADAHHAAYA
HHAHHAADAHHAADAHHAAYAHHAHHAADAHHAADAHHATDAHHAHHAADAHHATDAHHA
ADAHHAADAHHATDAHHAADAHHATDAHHAADAHHAADAHHATDSHHAHHAADAHHAAAH
HATDAHHAAAHHATDAHHAAAHHEAATHCLRH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50015214
n/a
NameBDBM50015214
Synonyms:6-chloro-2-methoxy-9-acridinyl(4-diethylamino-1-methylbutyl)amine | 6-chloro-N-(5-(diethylamino)pentan-2-yl)-2-methoxyacridin-9-amine | CHEMBL7568 | N'-(6-chloro-2-methoxy-acridin-9-yl)-N,N-diethyl-pentane-1,4-diamine | N*4*-(6-Chloro-2-methoxy-acridin-9-yl)-N*1*,N*1*-diethyl-pentane-1,4-diamine | N*4*-(6-Chloro-2-methoxy-acridin-9-yl)-N*1*,N*1*-diethyl-pentane-1,4-diamine (Mepacrine) | N*4*-(6-Chloro-2-methoxy-acridin-9-yl)-N*1*,N*1*-diethyl-pentane-1,4-diamine ; (mepacrine) | N-(4-Hydroxy-phenyl)-acetamide | cid_237 | quinacrine
TypeSmall organic molecule
Emp. Form.C23H30ClN3O
Mol. Mass.399.957
SMILESCCN(CC)CCCC(C)Nc1c2ccc(Cl)cc2nc2ccc(OC)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: