Reaction Details |
| Report a problem with these data |
Target | fMet-Leu-Phe receptor |
---|
Ligand | BDBM50027800 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_744776 (CHEMBL1772797) |
---|
IC50 | 2512±n/a nM |
---|
Citation | Unitt, J; Fagura, M; Phillips, T; King, S; Perry, M; Morley, A; MacDonald, C; Weaver, R; Christie, J; Barber, S; Mohammed, R; Paul, M; Cook, A; Baxter, A Discovery of small molecule human FPR1 receptor antagonists. Bioorg Med Chem Lett21:2991-7 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
fMet-Leu-Phe receptor |
---|
Name: | fMet-Leu-Phe receptor |
Synonyms: | FPR | FPR1 | FPR1_HUMAN | Formyl peptide Receptor | N-formyl peptide receptor 1 | N-formylpeptide chemoattractant receptor | fMLP receptor | fMet-Leu-Phe receptor | formyl peptide receptor 1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 38456.14 |
Organism: | Homo sapiens (Human) |
Description: | gi_4503779 |
Residue: | 350 |
Sequence: | METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVT
TISYLNLAVADFCFTSTLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIA
LDRCVCVLHPVWTQNHRTVSLAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNF
SPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGLIATKIHKQGLIKSSRPL
RVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPML
YVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK
|
|
|
BDBM50027800 |
---|
n/a |
---|
Name | BDBM50027800 |
Synonyms: | CHEMBL1770296 |
Type | Small organic molecule |
Emp. Form. | C25H39N3O6S |
Mol. Mass. | 509.659 |
SMILES | CSCC[C@H](NC(=O)OC(C)(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1ccccc1)C(O)=O |r| |
Structure |
|