Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPotassium channel protein TASK-1
LigandBDBM50426570
Substrate/Competitorn/a
Meas. Tech.ChEMBL_938657
IC50 300±n/a nM
Citation Bagal SKBrown ADCox PJOmoto KOwen RMPryde DCSidders BSkerratt SEStevens EBStorer RISwain NA Ion channels as therapeutic targets: a drug discovery perspective. J Med Chem 56:593-624 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Potassium channel protein TASK-1
Name:Potassium channel protein TASK-1
Synonyms:Acid-sensitive potassium channel TASK-1 | Acid-sensitive potassium channel protein TASK-1 | KCNK3 | Potassium channel subfamily K member 3 | Potassium channel subfamily K member 3 (TASK-1) | TASK | TASK1 | TWIK-related acid-sensitive K(+) channel 1 | Two pore K(+) channel KT3.1 | Two pore potassium channel KT3.1
Type:Protein
Mol. Mass.:43534.71
Organism:Homo sapiens (Human)
Description:O14649
Residue:394
Sequence:
MKRQNVRTLALIVCTFTYLLVGAAVFDALESEPELIERQRLELRQQELRARYNLSQGGYE
ELERVVLRLKPHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPL
TLVMFQSLGERINTLVRYLLHRAKKGLGMRRADVSMANMVLIGFFSCISTLCIGAAAFSH
YEHWTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVAFSFVYILTGLTVIGAFLN
LVVLRFMTMNAEDEKRDAEHRALLTRNGQAGGGGGGGSAHTTDTASSTAAAGGGGFRNVY
AEVLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSDTCVEQSHSSPGGGGRYSDTPSRR
CLCSGAPRSAISSVSTGLHSLSTFRGLMKRRSSV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50426570
n/a
NameBDBM50426570
Synonyms:CHEMBL2324344
TypeSmall organic molecule
Emp. Form.C29H32N4O2
Mol. Mass.468.59
SMILESCCCC(=O)C1CCN(CC1)c1ncnc2CCN(Cc12)C(=O)c1ccc(cc1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: