Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAmiloride-sensitive cation channel 3
LigandBDBM50157090
Substrate/Competitorn/a
Meas. Tech.ChEMBL_938637
IC50 9500±n/a nM
Citation Bagal SKBrown ADCox PJOmoto KOwen RMPryde DCSidders BSkerratt SEStevens EBStorer RISwain NA Ion channels as therapeutic targets: a drug discovery perspective. J Med Chem 56:593-624 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Amiloride-sensitive cation channel 3
Name:Amiloride-sensitive cation channel 3
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:59229.99
Organism:Rattus norvegicus
Description:ChEMBL_938637
Residue:533
Sequence:
MKPRSGLEEAQRRQASDIRVFASSCTMHGLGHIFGPGGLTLRRGLWATAVLLSLAAFLYQ
VAERVRYYGEFHHKTTLDERESHQLTFPAVTLCNINPLRRSRLTPNDLHWAGTALLGLDP
AEHAAYLRALGQPPAPPGFMPSPTFDMAQLYARAGHSLEDMLLDCRYRGQPCGPENFTVI
FTRMGQCYTFNSGAHGAELLTTPKGGAGNGLEIMLDVQQEEYLPIWKDMEETPFEVGIRV
QIHSQDEPPAIDQLGFGAAPGHQTFVSCQQQQLSFLPPPWGDCNTASLDPDDFDPEPSDP
LGSPRPRPSPPYSLIGCRLACESRYVARKCGCRMMHMPGNSPVCSPQQYKDCASPALDAM
LRKDTCVCPNPCATTRYAKELSMVRIPSRASARYLARKYNRSESYITENVLVLDIFFEAL
NYEAVEQKAAYEVSELLGDIGGQMGLFIGASLLTILEILDYLCEVFQDRVLGYFWNRRSA
QKRSGNTLLQEELNGHRTHVPHLSLGPRPPTTPCAVTKTLSASHRTCYLVTRL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50157090
n/a
NameBDBM50157090
Synonyms:6-(2-(1-isopropyl-2-methyl-1,2,3,4-tetrahydroisoquinolin-7-yl)cyclopropyl)-2-naphthimidamide | 6-[2-(1-Isopropyl-2-methyl-1,2,3,4-tetrahydro-isoquinolin-7-yl)-cyclopropyl]-naphthalene-2-carboxamidine | CHEMBL185515
TypeSmall organic molecule
Emp. Form.C27H31N3
Mol. Mass.397.5551
SMILESCC(C)C1N(C)CCc2ccc(cc12)C1CC1c1ccc2cc(ccc2c1)C(N)=N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: