Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGamma-aminobutyric acid receptor subunit alpha-5 (GABA(A))
LigandBDBM50156083
Substrate/Competitorn/a
Meas. Tech.ChEMBL_938810
Ki 1.4±n/a nM
Citation Bagal SKBrown ADCox PJOmoto KOwen RMPryde DCSidders BSkerratt SEStevens EBStorer RISwain NA Ion channels as therapeutic targets: a drug discovery perspective. J Med Chem 56:593-624 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Gamma-aminobutyric acid receptor subunit alpha-5 (GABA(A))
Name:Gamma-aminobutyric acid receptor subunit alpha-5/beta-3/gamma-3
Synonyms:GABA A Alpha5Beta1Gamma2 | GABA A Alpha5Beta3Gamma2 | GABA receptor alpha-5 subunit | GABA(A) receptor subunit alpha-5 (GABAAa5) | Gamma-aminobutyric acid receptor subunit alpha-5 | Gamma-aminobutyric acid receptor subunit alpha-5 (GABAA)
Type:Enzyme
Mol. Mass.:52160.59
Organism:Homo sapiens (Human)
Description:P31644
Residue:462
Sequence:
MDNGMFSGFIMIKNLLLFCISMNLSSHFGFSQMPTSSVKDETNDNITIFTRILDGLLDGY
DNRLRPGLGERITQVRTDIYVTSFGPVSDTEMEYTIDVFFRQSWKDERLRFKGPMQRLPL
NNLLASKIWTPDTFFHNGKKSIAHNMTTPNKLLRLEDDGTLLYTMRLTISAECPMQLEDF
PMDAHACPLKFGSYAYPNSEVVYVWTNGSTKSVVVAEDGSRLNQYHLMGQTVGTENISTS
TGEYTIMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTM
TTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKKALEAA
KIKKKREVILNKSTNAFTTGKMSHPPNIPKEQTPAGTSNTTSVSVKPSEEKTSESKKTYN
SISKIDKMSRIVFPVLFGTFNLVYWATYLNREPVIKGAASPK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50156083
n/a
NameBDBM50156083
Synonyms:3-tert-Butyl-7-(5-methyl-isoxazol-3-yl)-2-(2-methyl-2H-[1,2,4]triazol-3-ylmethoxy)-pyrazolo[1,5-d][1,2,4]triazine | 3-tert-butyl-7-(5-methylisoxazol-3-yl)-2-(1-methyl-1H-1,2,4-triazol-5-ylmethoxy)pyrazolo[1,5-d][1,2,4]-triazine | CHEMBL363211
TypeSmall organic molecule
Emp. Form.C17H20N8O2
Mol. Mass.368.3931
SMILESCc1cc(no1)-c1nncc2c(c(OCc3ncnn3C)nn12)C(C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: