Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGABA A receptor alpha-2/beta-2/gamma-2
LigandBDBM50179998
Substrate/Competitorn/a
Meas. Tech.ChEMBL_938811
Ki 0.70±n/a nM
Citation Bagal SKBrown ADCox PJOmoto KOwen RMPryde DCSidders BSkerratt SEStevens EBStorer RISwain NA Ion channels as therapeutic targets: a drug discovery perspective. J Med Chem 56:593-624 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
GABA A receptor alpha-2/beta-2/gamma-2
Name:Gamma-aminobutyric acid receptor subunit alpha-2/beta-2
Synonyms:GABA receptor alpha-2 subunit | Gamma-aminobutyric acid receptor subunit alpha-2 (GABRA2)
Type:Protein
Mol. Mass.:51338.78
Organism:Homo sapiens (Human)
Description:P47869
Residue:451
Sequence:
MKTKLNIYNMQFLLFVFLVWDPARLVLANIQEDEAKNNITIFTRILDRLLDGYDNRLRPG
LGDSITEVFTNIYVTSFGPVSDTDMEYTIDVFFRQKWKDERLKFKGPMNILRLNNLMASK
IWTPDTFFHNGKKSVAHNMTMPNKLLRIQDDGTLLYTMRLTVQAECPMHLEDFPMDAHSC
PLKFGSYAYTTSEVTYIWTYNASDSVQVAPDGSRLNQYDLLGQSIGKETIKSSTGEYTVM
TAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISA
RNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKSVVNDKKKEKASV
MIQNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKPENKPAEAKKTFNSVSKIDRM
SRIVFPVLFGTFNLVYWATYLNREPVLGVSP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50179998
n/a
NameBDBM50179998
Synonyms:7-tert-butyl-3-(2,5-difluorophenyl)-6-((2-methyl-2H-1,2,4-triazol-3-yl)methoxy)-[1,2,4]triazolo[4,3-b]pyridazine | CHEMBL373250
TypeSmall organic molecule
Emp. Form.C19H19F2N7O
Mol. Mass.399.3973
SMILESCn1ncnc1COc1nn2c(nnc2cc1C(C)(C)C)-c1cc(F)ccc1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: