| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Hypoxanthine-guanine phosphoribosyltransferase |
|---|
| Ligand | BDBM50427809 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_940694 (CHEMBL2329985) |
|---|
| Ki | 1000±n/a nM |
|---|
| Citation |  Keough, DT; Špacek, P; Hocková, D; Tichý, T; Vrbková, S; Slavetínská, L; Janeba, Z; Naesens, L; Edstein, MD; Chavchich, M; Wang, TH; de Jersey, J; Guddat, LW Acyclic nucleoside phosphonates containing a second phosphonate group are potent inhibitors of 6-oxopurine phosphoribosyltransferases and have antimalarial activity. J Med Chem56:2513-26 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Hypoxanthine-guanine phosphoribosyltransferase |
|---|
| Name: | Hypoxanthine-guanine phosphoribosyltransferase |
|---|
| Synonyms: | HGPRT | HGPRTase | HPRT | HPRT1 | HPRT_HUMAN | Hypoxanthine-guanine phosphoribosyltransferase | Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 24579.61 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P00492 |
|---|
| Residue: | 218 |
|---|
| Sequence: | MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGH
HIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGD
DLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVG
FEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
|
|
|
|---|
| BDBM50427809 |
|---|
| n/a |
|---|
| Name | BDBM50427809 |
|---|
| Synonyms: | CHEMBL2325753 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C11H18N4O9P2 |
|---|
| Mol. Mass. | 412.2295 |
|---|
| SMILES | OP(O)(=O)COCC(COCP(O)(O)=O)Cn1cnc2c1nc[nH]c2=O |
|---|
| Structure | 
|
|---|
Search and Browse
