| Reaction Details |
|---|
 | Report a problem with these data |
| Target | E3 ubiquitin-protein ligase XIAP |
|---|
| Ligand | BDBM50441817 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_988991 (CHEMBL2437637) |
|---|
| IC50 | 11±n/a nM |
|---|
| Citation |  Kester, RF; Donnell, AF; Lou, Y; Remiszewski, SW; Lombardo, LJ; Chen, S; Le, NT; Lo, J; Moliterni, JA; Han, X; Hogg, JH; Liang, W; Michoud, C; Rupert, KC; Mischke, S; Le, K; Weisel, M; Janson, CA; Lukacs, CM; Fretland, AJ; Hong, K; Polonskaia, A; Gao, L; Li, S; Solis, DS; Aguilar, D; Tardell, C; Dvorozniak, M; Tannu, S; Lee, EC; Schutt, AD; Goggin, B Optimization of benzodiazepinones as selective inhibitors of the X-linked inhibitor of apoptosis protein (XIAP) second baculovirus IAP repeat (BIR2) domain. J Med Chem56:7788-803 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| E3 ubiquitin-protein ligase XIAP |
|---|
| Name: | E3 ubiquitin-protein ligase XIAP |
|---|
| Synonyms: | API3 | BIRC4 | E3 ubiquitin-protein ligase XIAP | IAP3 | Inhibitor of apoptosis protein 3 | Inhibitor of apoptosis protein 3 (XIAP) | X-linked inhibitor of apoptosis | X-linked inhibitor of apoptosis protein (XIAP) | XIAP | XIAP_HUMAN |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 56685.27 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P98170 |
|---|
| Residue: | 497 |
|---|
| Sequence: | MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDT
VRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENY
LGSRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLT
PRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSE
SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKC
FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTTEKTP
SLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKD
SMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDK
CPMCYTVITFKQKIFMS
|
|
|
|---|
| BDBM50441817 |
|---|
| n/a |
|---|
| Name | BDBM50441817 |
|---|
| Synonyms: | CHEMBL2436332 | US10053431, 90b |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H30BrFN4O4 |
|---|
| Mol. Mass. | 633.507 |
|---|
| SMILES | CN[C@@H](C)C(=O)N[C@H]1CN(C(=O)c2cccc(F)c2)c2ccccc2N(Cc2c(OC)ccc3cc(Br)ccc23)C1=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
