| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Inward rectifier potassium channel 13 |
|---|
| Ligand | BDBM50442600 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_990651 (CHEMBL2443473) |
|---|
| IC50 | >10000±n/a nM |
|---|
| Citation |  Tang, H; de Jesus, RK; Walsh, SP; Zhu, Y; Yan, Y; Priest, BT; Swensen, AM; Alonso-Galicia, M; Felix, JP; Brochu, RM; Bailey, T; Thomas-Fowlkes, B; Zhou, X; Pai, LY; Hampton, C; Hernandez, M; Owens, K; Roy, S; Kaczorowski, GJ; Yang, L; Garcia, ML; Pasternak, A Discovery of a novel sub-class of ROMK channel inhibitors typified by 5-(2-(4-(2-(4-(1H-Tetrazol-1-yl)phenyl)acetyl)piperazin-1-yl)ethyl)isobenzofuran-1(3H)-one. Bioorg Med Chem Lett23:5829-32 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Inward rectifier potassium channel 13 |
|---|
| Name: | Inward rectifier potassium channel 13 |
|---|
| Synonyms: | Inward rectifier K(+) channel Kir7.1 | KCJ13_HUMAN | KCNJ13 | Potassium channel, inwardly rectifying subfamily J member 13 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 40527.12 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_105176 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MDSSNCKVIAPLLSQRYRRMVTKDGHSTLQMDGAQRGLAYLRDAWGILMDMRWRWMMLVF
SASFVVHWLVFAVLWYVLAEMNGDLELDHDAPPENHTICVKYITSFTAAFSFSLETQLTI
GYGTMFPSGDCPSAIALLAIQMLLGLMLEAFITGAFVAKIARPKNRAFSIRFTDTAVVAH
MDGKPNLIFQVANTRPSPLTSVRVSAVLYQERENGKLYQTSVDFHLDGISSDECPFFIFP
LTYYHSITPSSPLATLLQHENPSHFELVVFLSAMQEGTGEICQRRTSYLPSEIMLHHCFA
SLLTRGSKGEYQIKMENFDKTVPEFPTPLVSKSPNRTDLDIHINGQSIDNFQISETGLTE
|
|
|
|---|
| BDBM50442600 |
|---|
| n/a |
|---|
| Name | BDBM50442600 |
|---|
| Synonyms: | CHEMBL2441437 | US9056859, 1 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H24N6O3 |
|---|
| Mol. Mass. | 432.4751 |
|---|
| SMILES | O=C(Cc1ccc(cc1)-n1cnnn1)N1CCN(CCc2ccc3C(=O)OCc3c2)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
