Reaction Details |
| Report a problem with these data |
Target | Inward rectifier potassium channel 13 |
---|
Ligand | BDBM50442600 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_990651 (CHEMBL2443473) |
---|
IC50 | >10000±n/a nM |
---|
Citation | Tang, H; de Jesus, RK; Walsh, SP; Zhu, Y; Yan, Y; Priest, BT; Swensen, AM; Alonso-Galicia, M; Felix, JP; Brochu, RM; Bailey, T; Thomas-Fowlkes, B; Zhou, X; Pai, LY; Hampton, C; Hernandez, M; Owens, K; Roy, S; Kaczorowski, GJ; Yang, L; Garcia, ML; Pasternak, A Discovery of a novel sub-class of ROMK channel inhibitors typified by 5-(2-(4-(2-(4-(1H-Tetrazol-1-yl)phenyl)acetyl)piperazin-1-yl)ethyl)isobenzofuran-1(3H)-one. Bioorg Med Chem Lett23:5829-32 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Inward rectifier potassium channel 13 |
---|
Name: | Inward rectifier potassium channel 13 |
Synonyms: | Inward rectifier K(+) channel Kir7.1 | KCJ13_HUMAN | KCNJ13 | Potassium channel, inwardly rectifying subfamily J member 13 |
Type: | PROTEIN |
Mol. Mass.: | 40527.12 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_105176 |
Residue: | 360 |
Sequence: | MDSSNCKVIAPLLSQRYRRMVTKDGHSTLQMDGAQRGLAYLRDAWGILMDMRWRWMMLVF
SASFVVHWLVFAVLWYVLAEMNGDLELDHDAPPENHTICVKYITSFTAAFSFSLETQLTI
GYGTMFPSGDCPSAIALLAIQMLLGLMLEAFITGAFVAKIARPKNRAFSIRFTDTAVVAH
MDGKPNLIFQVANTRPSPLTSVRVSAVLYQERENGKLYQTSVDFHLDGISSDECPFFIFP
LTYYHSITPSSPLATLLQHENPSHFELVVFLSAMQEGTGEICQRRTSYLPSEIMLHHCFA
SLLTRGSKGEYQIKMENFDKTVPEFPTPLVSKSPNRTDLDIHINGQSIDNFQISETGLTE
|
|
|
BDBM50442600 |
---|
n/a |
---|
Name | BDBM50442600 |
Synonyms: | CHEMBL2441437 | US9056859, 1 |
Type | Small organic molecule |
Emp. Form. | C23H24N6O3 |
Mol. Mass. | 432.4751 |
SMILES | O=C(Cc1ccc(cc1)-n1cnnn1)N1CCN(CCc2ccc3C(=O)OCc3c2)CC1 |
Structure |
|