Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInward rectifier potassium channel 13
LigandBDBM50442600
Substrate/Competitorn/a
Meas. Tech.ChEMBL_990651
IC50>10000±n/a nM
Citation Tang Hde Jesus RKWalsh SPZhu YYan YPriest BTSwensen AMAlonso-Galicia MFelix JPBrochu RMBailey TThomas-Fowlkes BZhou XPai LYHampton CHernandez MOwens KRoy SKaczorowski GJYang LGarcia MLPasternak A Discovery of a novel sub-class of ROMK channel inhibitors typified by 5-(2-(4-(2-(4-(1H-Tetrazol-1-yl)phenyl)acetyl)piperazin-1-yl)ethyl)isobenzofuran-1(3H)-one. Bioorg Med Chem Lett 23:5829-32 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Inward rectifier potassium channel 13
Name:Inward rectifier potassium channel 13
Synonyms:Inward rectifier K(+) channel Kir7.1 | KCNJ13 | Potassium channel, inwardly rectifying subfamily J member 13
Type:PROTEIN
Mol. Mass.:40527.12
Organism:Homo sapiens (Human)
Description:ChEMBL_105176
Residue:360
Sequence:
MDSSNCKVIAPLLSQRYRRMVTKDGHSTLQMDGAQRGLAYLRDAWGILMDMRWRWMMLVF
SASFVVHWLVFAVLWYVLAEMNGDLELDHDAPPENHTICVKYITSFTAAFSFSLETQLTI
GYGTMFPSGDCPSAIALLAIQMLLGLMLEAFITGAFVAKIARPKNRAFSIRFTDTAVVAH
MDGKPNLIFQVANTRPSPLTSVRVSAVLYQERENGKLYQTSVDFHLDGISSDECPFFIFP
LTYYHSITPSSPLATLLQHENPSHFELVVFLSAMQEGTGEICQRRTSYLPSEIMLHHCFA
SLLTRGSKGEYQIKMENFDKTVPEFPTPLVSKSPNRTDLDIHINGQSIDNFQISETGLTE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50442600
n/a
NameBDBM50442600
Synonyms:CHEMBL2441437 | US9056859, 1
TypeSmall organic molecule
Emp. Form.C23H24N6O3
Mol. Mass.432.4751
SMILESO=C(Cc1ccc(cc1)-n1cnnn1)N1CCN(CCc2ccc3C(=O)OCc3c2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: