Reaction Details |
| Report a problem with these data |
Target | Histamine H2 receptor |
---|
Ligand | BDBM50444496 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1277729 (CHEMBL3097145) |
---|
Ki | >3162±n/a nM |
---|
Citation | Wilson, DM; Apps, J; Bailey, N; Bamford, MJ; Beresford, IJ; Brackenborough, K; Briggs, MA; Brough, S; Calver, AR; Crook, B; Davis, RK; Davis, RP; Davis, S; Dean, DK; Harris, L; Heslop, T; Holland, V; Jeffrey, P; Panchal, TA; Parr, CA; Quashie, N; Schogger, J; Sehmi, SS; Stean, TO; Steadman, JG; Trail, B; Wald, J; Worby, A; Takle, AK; Witherington, J; Medhurst, AD Identification of clinical candidates from the benzazepine class of histamine H3 receptor antagonists. Bioorg Med Chem Lett23:6890-6 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Histamine H2 receptor |
---|
Name: | Histamine H2 receptor |
Synonyms: | Gastric receptor I | H2R | HISTAMINE H2 | HRH2 | HRH2_HUMAN | Histamine H2 receptor | Histamine H2-Gs alpha S |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40115.31 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 359 |
Sequence: | MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSL
AITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
MDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNE
VYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVM
GAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQ
QLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR
|
|
|
BDBM50444496 |
---|
n/a |
---|
Name | BDBM50444496 |
Synonyms: | CHEMBL3092650 |
Type | Small organic molecule |
Emp. Form. | C23H27N3O2 |
Mol. Mass. | 377.4794 |
SMILES | O=C1CCCN1c1ccc(Oc2ccc3CCN(CCc3c2)C2CCC2)nc1 |
Structure |
|