Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNicotinic acetylcholine receptor alpha6/alpha3/beta2/beta3
LigandBDBM50445331
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1285314
IC50>10000±n/a nM
Citation Luo SZhangsun DZhu XWu YHu YChristensen SHarvey PJAkcan MCraik DJMcIntosh JM Characterization of a novela-conotoxin TxID from Conus textile that potently blocks rata34 nicotinic acetylcholine receptors. J Med Chem 56:9655-63 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Nicotinic acetylcholine receptor alpha6/alpha3/beta2/beta3
Name:Nicotinic acetylcholine receptor alpha6/alpha3/beta2/beta3
Synonyms:n/a
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of ChEMBL is 1285295
Components:This complex has 4 components.
Component 1
Name:Neuronal acetylcholine receptor subunit alpha-6/beta-3
Synonyms:Neuronal acetylcholine receptor subunit alpha-6
Type:PROTEIN
Mol. Mass.:56943.53
Organism:Rattus norvegicus
Description:ChEMBL_1454451
Residue:493
Sequence:
MLNGWGRGDLRSGLCLWICGFLAFFKGSRGCVSEEQLFHTLFAHYNRFIRPVENVSDPVT
VHFELAITQLANVDEVNQIMETNLWLRHVWKDYRLCWDPTEYDGIETLRVPADNIWKPDI
VLYNNAVGDFQVEGKTKALLKYDGVITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWT
YDKAEIDLLIIGSKVDMNDFWENSEWEIVDASGYKHDIKYNCCEEIYTDITYSFYIRRLP
MFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVI
PLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPATHTMPKWVKTMFLQVFPSILMMRRPLD
KTKEMDGVKDPKTHTKRPAKVKFTHRKEPKLLKECRHCHKSSEIAPGKRLSQQPAQWVTE
NSEHPPDVEDVIDSVQFIAENMKSHNETKEVEDDWKYMAMVVDRVFLWVFIIVCVFGTVG
LFLQPLLGNTGAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:NIcotinic acetylcholine receptor alpha-3/beta-4/alpha-5
Synonyms:Cholinergic, Nicotinic Alpha3Beta2 | Neuronal acetylcholine receptor protein alpha-3 subunit | Nicotinic acetylcholine receptor alpha6/alpha3/beta4
Type:Enzyme
Mol. Mass.:56995.52
Organism:Rattus norvegicus (Rat)
Description:P04757
Residue:499
Sequence:
MGVVLLPPPLSMLMLVLMLLPAASASEAEHRLFQYLFEDYNEIIRPVANVSHPVIIQFEV
SMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLYNN
ADGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAK
IDLVLIGSSMNLKDYWESGEWAIIKAPGYKHEIKYNCCEEIYQDITYSLYIRRLPLFYTI
NLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGE
YLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPTWVKAVFLNLLPRVMFMTRPTSGEGDT
PKTRTFYGAELSNLNCFSRADSKSCKEGYPCQDGTCGYCHHRRVKISNFSANLTRSSSSE
SVNAVLSLSALSPEIKEAIQSVKYIAENMKAQNVAKEIQDDWKYVAMVIDRIFLWVFILV
CILGTAGLFLQPLMARDDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 3
Name:Neuronal acetylcholine receptor protein beta-3 subunit
Synonyms:Neuronal acetylcholine receptor subunit beta-3
Type:PROTEIN
Mol. Mass.:53270.05
Organism:Rattus norvegicus
Description:EBI_10644
Residue:464
Sequence:
MTGFLRVFLVLSATLSGSWVTLTATAGLSSVAEHEDALLRHLFQGYQKWVRPVLNSSDII
KVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDQKLRWNPEEYGGINSIKVPSESLWLPD
IVLFENADGRFEGSLMTKAIVKSSGTVSWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSW
TYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRREGFYSYPFVTYSFVLRRLPL
FYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIP
LIGEYLLFIMIFVTLSIIVTVFVINVHHRSSSTYHPMAPWVKRLFLQRLPRWLCMKDPMD
RFSFPDGKESDTAVRGKVSGKRKQTPASDGERVLVAFLEKASESIRYISRHVKKEHFISQ
VVQDWKFVAQVLDRIFLWLFLIASVLGSILIFIPALKMWIHRFH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 4
Name:Neuronal acetylcholine receptor protein beta-3 subunit
Synonyms:Neuronal acetylcholine receptor subunit beta-3
Type:PROTEIN
Mol. Mass.:53270.05
Organism:Rattus norvegicus
Description:EBI_10644
Residue:464
Sequence:
MTGFLRVFLVLSATLSGSWVTLTATAGLSSVAEHEDALLRHLFQGYQKWVRPVLNSSDII
KVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDQKLRWNPEEYGGINSIKVPSESLWLPD
IVLFENADGRFEGSLMTKAIVKSSGTVSWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSW
TYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRREGFYSYPFVTYSFVLRRLPL
FYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIP
LIGEYLLFIMIFVTLSIIVTVFVINVHHRSSSTYHPMAPWVKRLFLQRLPRWLCMKDPMD
RFSFPDGKESDTAVRGKVSGKRKQTPASDGERVLVAFLEKASESIRYISRHVKKEHFISQ
VVQDWKFVAQVLDRIFLWLFLIASVLGSILIFIPALKMWIHRFH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50445331
n/a
NameBDBM50445331
Synonyms:CHEMBL3104245
TypeSmall organic molecule
Emp. Form.C58H92N18O18S5
Mol. Mass.1489.786
SMILESCC[C@H](C)[C@@H]1NC(=O)[C@@H]2CCCN2C(=O)[C@H](CO)NC(=O)[C@H](CCSC)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@@H]2CSSC[C@H](NC(=O)CN)C(=O)N[C@@H](CSSC[C@H](NC1=O)C(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N2 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: