Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase Nek2
LigandBDBM50446431
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1287782
IC50>100000±n/a nM
Citation Naud SWestwood IMFaisal ASheldrake PBavetsias VAtrash BCheung KMLiu MHayes ASchmitt JWood AChoi VBoxall KMak GGurden MValenti Mde Haven Brandon AHenley ABaker RMcAndrew CMatijssen BBurke RHoelder SEccles SARaynaud FILinardopoulos Svan Montfort RLBlagg J Structure-based design of orally bioavailable 1H-pyrrolo[3,2-c]pyridine inhibitors of mitotic kinase monopolar spindle 1 (MPS1). J Med Chem 56:10045-65 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase Nek2
Name:Serine/threonine-protein kinase NEK2
Synonyms:NEK2
Type:Enzyme
Mol. Mass.:51776.96
Organism:Homo sapiens (Human)
Description:P51955
Residue:445
Sequence:
MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLR
ELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQL
TLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKTFVGTP
YYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRY
SDELNEIITRMLNLKDYHRPSVEEILENPLIADLVADEQRRNLERRGRQLGEPEKSQDSS
PVLSELKLKEIQLQERERALKAREERLEQKEQELCVRERLAEDKLARAENLLKNYSLLKE
RKFLSLASNPELLNLPSSVIKKKVHFSGESKENIMRSENSESQLTSKSKCKDLKKRLHAA
QLRAQALSDIEKNYQLKSRQILGMR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50446431
n/a
NameBDBM50446431
Synonyms:CHEMBL3109933
TypeSmall organic molecule
Emp. Form.C25H27ClN6O3
Mol. Mass.494.973
SMILESCN(C)C(=O)c1ccc(Nc2cc3n(C(=O)OC(C)(C)C)c(cc3cn2)-c2cnn(C)c2)c(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: