| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Integrase |
|---|
| Ligand | BDBM50004364 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1336114 (CHEMBL3240942) |
|---|
| IC50 | 50±n/a nM |
|---|
| Citation |  Costi, R; Métifiot, M; Chung, S; Cuzzucoli Crucitti, G; Maddali, K; Pescatori, L; Messore, A; Madia, VN; Pupo, G; Scipione, L; Tortorella, S; Di Leva, FS; Cosconati, S; Marinelli, L; Novellino, E; Le Grice, SF; Corona, A; Pommier, Y; Marchand, C; Di Santo, R Basic quinolinonyl diketo acid derivatives as inhibitors of HIV integrase and their activity against RNase H function of reverse transcriptase. J Med Chem57:3223-34 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Integrase |
|---|
| Name: | Integrase |
|---|
| Synonyms: | Human immunodeficiency virus type 1 integrase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 32231.48 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | ChEMBL_90865 |
|---|
| Residue: | 288 |
|---|
| Sequence: | FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED
|
|
|
|---|
| BDBM50004364 |
|---|
| n/a |
|---|
| Name | BDBM50004364 |
|---|
| Synonyms: | CHEMBL3238134 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H27ClFN3O5 |
|---|
| Mol. Mass. | 527.972 |
|---|
| SMILES | OC(=O)C(\O)=C\C(=O)c1cn(Cc2ccc(F)cc2)c2cc(ccc2c1=O)N1CCN(CCCCl)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
