| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Integrase |
|---|
| Ligand | BDBM50021287 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1366289 (CHEMBL3297622) |
|---|
| Kd | 24±n/a nM |
|---|
| Citation |  Fader, LD; Carson, R; Morin, S; Bilodeau, F; Chabot, C; Halmos, T; Bailey, MD; Kawai, SH; Coulombe, R; Laplante, S; Mekhssian, K; Jakalian, A; Garneau, M; Duan, J; Mason, SW; Simoneau, B; Fenwick, C; Tsantrizos, Y; Yoakim, C Minimizing the Contribution of Enterohepatic Recirculation to Clearance in Rat for the NCINI Class of Inhibitors of HIV. ACS Med Chem Lett5:711-6 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Integrase |
|---|
| Name: | Integrase |
|---|
| Synonyms: | Human immunodeficiency virus type 1 integrase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 32231.48 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | ChEMBL_90865 |
|---|
| Residue: | 288 |
|---|
| Sequence: | FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED
|
|
|
|---|
| BDBM50021287 |
|---|
| n/a |
|---|
| Name | BDBM50021287 |
|---|
| Synonyms: | CHEMBL3287920 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H34N2O4 |
|---|
| Mol. Mass. | 522.6341 |
|---|
| SMILES | Cc1nc(c(C)c(-c2ccc3OCCCc3c2)c1[C@H](OC(C)(C)C)C(O)=O)-c1ccc(cc1)-c1ccncc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
