| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Env polyprotein |
|---|
| Ligand | BDBM50023616 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1455137 (CHEMBL3366750) |
|---|
| EC50 | 2183±n/a nM |
|---|
| Citation |  Wang, C; Lu, L; Na, H; Li, X; Wang, Q; Jiang, X; Xu, X; Yu, F; Zhang, T; Li, J; Zhang, Z; Zheng, B; Liang, G; Cai, L; Jiang, S; Liu, K Conjugation of a nonspecific antiviral sapogenin with a specific HIV fusion inhibitor: a promising strategy for discovering new antiviral therapeutics. J Med Chem57:7342-54 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Env polyprotein |
|---|
| Name: | Env polyprotein |
|---|
| Synonyms: | ENV | GP41 | HIV1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 14017.92 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | ChEMBL_109731 |
|---|
| Residue: | 124 |
|---|
| Sequence: | FLGFLGAAGSTMGAASITLTVQARTLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQA
RVLAVERYLQDQQLLGIWGCSGKHICTTTVPWNSSWSNKSLEEIWQNMTWMEWEREIDNY
TGLI
|
|
|
|---|
| BDBM50023616 |
|---|
| n/a |
|---|
| Name | BDBM50023616 |
|---|
| Synonyms: | CHEMBL3341860 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C149H238N44O53 |
|---|
| Mol. Mass. | 3493.747 |
|---|
| SMILES | CCCc1cn(CC(=O)NCCCC[C@H](NC(=O)CCNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](Cc2cnc[nH]2)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](Cc2ccc(O)cc2)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(C)=O)[C@@H](C)O)[C@@H](C)CC)[C@@H](C)CC)C(N)=O)nn1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
