Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBromodomain and PHD finger-containing protein 3
LigandBDBM50028142
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1434752
IC50<1.000000±n/a nM
Citation Gosmini RNguyen VLToum JSimon CBrusq JMKrysa GMirguet ORiou-Eymard AMBoursier EVTrottet LBamborough PClark HChung CWCutler LDemont EHKaur RLewis AJSchilling MBSoden PETaylor SWalker ALWalker MDPrinjha RKNicodème E The discovery of I-BET726 (GSK1324726A), a potent tetrahydroquinoline ApoA1 up-regulator and selective BET bromodomain inhibitor. J Med Chem 57:8111-31 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bromodomain and PHD finger-containing protein 3
Name:Bromodomain and PHD finger-containing protein 3
Synonyms:BRPF3 | Bromodomain and PHD finger-containing protein 3 | KIAA1286
Type:PROTEIN
Mol. Mass.:135743.95
Organism:Homo sapiens (Human)
Description:ChEMBL_108004
Residue:1205
Sequence:
MRKPRRKSRQNAEGRRSPSPYSLKCSPTRETLTYAQAQRIVEVDIDGRLHRISIYDPLKI
ITEDELTAQDITECNSNKENSEQPQFPGKSKKPSSKGKKKESCSKHASGTSFHLPQPSFR
MVDSGIQPEAPPLPAAYYRYIEKPPEDLDAEVEYDMDEEDLAWLDMVNEKRRVDGHSLVS
ADTFELLVDRLEKESYLESRSSGAQQSLIDEDAFCCVCLDDECHNSNVILFCDICNLAVH
QECYGVPYIPEGQWLCRCCLQSPSRPVDCILCPNKGGAFKQTSDGHWAHVVCAIWIPEVC
FANTVFLEPIEGIDNIPPARWKLTCYICKQKGLGAAIQCHKVNCYTAFHVTCAQRAGLFM
KIEPMRETSLNGTIFTVRKTAYCEAHSPPGAATARRKGDSPRSISETGDEEGLKEGDGEE
EEEEEVEEEEQEAQGGVSGSLKGVPKKSKMSLKQKIKKEPEEAGQDTPSTLPMLAVPQIP
SYRLNKICSGLSFQRKNQFMQRLHNYWLLKRQARNGVPLIRRLHSHLQSQRNAEQREQDE
KTSAVKEELKYWQKLRHDLERARLLIELIRKREKLKREQVKVQQAAMELELMPFNVLLRT
TLDLLQEKDPAHIFAEPVNLSEVPDYLEFISKPMDFSTMRRKLESHLYRTLEEFEEDFNL
IVTNCMKYNAKDTIFHRAAVRLRDLGGAILRHARRQAENIGYDPERGTHLPESPKLEDFY
RFSWEDVDNILIPENRAHLSPEVQLKELLEKLDLVSAMRSSGARTRRVRLLRREINALRQ
KLAQPPPPQPPSLNKTVSNGELPAGPQGDAAVLEQALQEEPEDDGDRDDSKLPPPPTLEP
TGPAPSLSEQESPPEPPTLKPINDSKPPSRFLKPRKVEEDELLEKSPLQLGNEPLQRLLS
DNGINRLSLMAPDTPAGTPLSGVGRRTSVLFKKAKNGVKLQRSPDRVLENGEDHGVAGSP
ASPASIEEERHSRKRPRSRSCSESEGERSPQQEEETGMTNGFGKHTESGSDSECSLGLSG
GLAFEACSGLTPPKRSRGKPALSRVPFLEGVNGDSDYNGSGRSLLLPFEDRGDLEPLELV
WAKCRGYPSYPALIIDPKMPREGLLHNGVPIPVPPLDVLKLGEQKQAEAGEKLFLVLFFD
NKRTWQWLPRDKVLPLGVEDTVDKLKMLEGRKTSIRKSVQVAYDRAMIHLSRVRGPHSFV
TSSYL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50028142
n/a
NameBDBM50028142
Synonyms:CHEMBL2177300
TypeSmall organic molecule
Emp. Form.C25H23ClN2O3
Mol. Mass.434.915
SMILESC[C@H]1C[C@@H](Nc2ccc(Cl)cc2)c2cc(ccc2N1C(C)=O)-c1ccc(cc1)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: