Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase A |
---|
Ligand | BDBM50030494 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1436352 (CHEMBL3388994) |
---|
Kd | 1.1±n/a nM |
---|
Citation | Fu, J; Tjandra, M; Becker, C; Bednarczyk, D; Capparelli, M; Elling, R; Hanna, I; Fujimoto, R; Furegati, M; Karur, S; Kasprzyk, T; Knapp, M; Leung, K; Li, X; Lu, P; Mergo, W; Miault, C; Ng, S; Parker, D; Peng, Y; Roggo, S; Rivkin, A; Simmons, RL; Wang, M; Wiedmann, B; Weiss, AH; Xiao, L; Xie, L; Xu, W; Yifru, A; Yang, S; Zhou, B; Sweeney, ZK Potent nonimmunosuppressive cyclophilin inhibitors with improved pharmaceutical properties and decreased transporter inhibition. J Med Chem57:8503-16 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase A |
---|
Name: | Peptidyl-prolyl cis-trans isomerase A |
Synonyms: | CYPA | CYPA PPIase | Cyclophilin A | Cyclosporin A-binding protein | PPIA | PPIA_HUMAN | PPIase A | Peptidyl-prolyl cis-trans isomerase A | Rotamase A |
Type: | Protein |
Mol. Mass.: | 18015.32 |
Organism: | Homo sapiens (Human) |
Description: | P62937 |
Residue: | 165 |
Sequence: | MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGF
MCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE
WLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
|
|
|
BDBM50030494 |
---|
n/a |
---|
Name | BDBM50030494 |
Synonyms: | CHEMBL3344503 |
Type | Small organic molecule |
Emp. Form. | C68H122N12O14 |
Mol. Mass. | 1331.7683 |
SMILES | [H][C@@]1([C@H](C)COCCN2CCOCC2)N(C)C(=O)[C@@H](C)N(C)C(=O)[C@H](CC)NC(=O)[C@]([H])([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](NC1=O)C(C)C |r| |
Structure |
|