Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone-lysine N-methyltransferase SUV39H1
LigandBDBM50031317
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1436394
IC50>150000±n/a nM
Citation Chen SWang YZhou WLi SPeng JShi ZHu JLiu YCDing HLin YLi LCheng SLiu JLu TJiang HLiu BZheng MLuo C Identifying novel selective non-nucleoside DNA methyltransferase 1 inhibitors through docking-based virtual screening. J Med Chem 57:9028-41 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone-lysine N-methyltransferase SUV39H1
Name:Histone-lysine N-methyltransferase SUV39H1
Synonyms:H3-K9-HMTase 1 | Histone H3-K9 methyltransferase 1 | KMT1A | Lysine N-methyltransferase 1A | Position-effect variegation 3-9 homolog | SUV39H | SUV39H1 | Su(var)3-9 homolog 1 | Suppressor of variegation 3-9 homolog 1
Type:PROTEIN
Mol. Mass.:47917.07
Organism:Homo sapiens (Human)
Description:ChEMBL_1473655
Residue:412
Sequence:
MAENLKGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLCDYKKIREQEYY
LVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKTPRHLDPSLANYLVQ
KAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVAVG
CECQDCLWAPTGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRVVQKG
IRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFD
LDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAGEE
LTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50031317
n/a
NameBDBM50031317
Synonyms:CHEMBL3358015
TypeSmall organic molecule
Emp. Form.C25H25N3O
Mol. Mass.383.4855
SMILESOC(CNCCc1c[nH]c2ccccc12)Cn1c2ccccc2c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: