Reaction Details |
| Report a problem with these data |
Target | Hypoxanthine-guanine phosphoribosyltransferase |
---|
Ligand | BDBM50392261 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1461452 (CHEMBL3396536) |
---|
Ki | 70±n/a nM |
---|
Citation | Keough, DT; Hocková, D; Janeba, Z; Wang, TH; Naesens, L; Edstein, MD; Chavchich, M; Guddat, LW Aza-acyclic nucleoside phosphonates containing a second phosphonate group as inhibitors of the human, Plasmodium falciparum and vivax 6-oxopurine phosphoribosyltransferases and their prodrugs as antimalarial agents. J Med Chem58:827-46 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Hypoxanthine-guanine phosphoribosyltransferase |
---|
Name: | Hypoxanthine-guanine phosphoribosyltransferase |
Synonyms: | HGPRT | HGPRTase | HPRT | HPRT1 | HPRT_HUMAN | Hypoxanthine-guanine phosphoribosyltransferase | Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) |
Type: | Protein |
Mol. Mass.: | 24579.61 |
Organism: | Homo sapiens (Human) |
Description: | P00492 |
Residue: | 218 |
Sequence: | MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGH
HIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGD
DLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVG
FEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
|
|
|
BDBM50392261 |
---|
n/a |
---|
Name | BDBM50392261 |
Synonyms: | CHEMBL2153480 |
Type | Small organic molecule |
Emp. Form. | C12H18N7O4P |
Mol. Mass. | 355.2896 |
SMILES | Nc1nc2n(CCN(CCC#N)CCP(O)(O)=O)cnc2c(=O)[nH]1 |
Structure |
|