Reaction Details |
| Report a problem with these data |
Target | Reverse transcriptase |
---|
Ligand | BDBM50076169 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1473838 (CHEMBL3418915) |
---|
IC50 | 14000±n/a nM |
---|
Citation | Cuzzucoli Crucitti, G; Métifiot, M; Pescatori, L; Messore, A; Madia, VN; Pupo, G; Saccoliti, F; Scipione, L; Tortorella, S; Esposito, F; Corona, A; Cadeddu, M; Marchand, C; Pommier, Y; Tramontano, E; Costi, R; Di Santo, R Structure-activity relationship of pyrrolyl diketo acid derivatives as dual inhibitors of HIV-1 integrase and reverse transcriptase ribonuclease H domain. J Med Chem58:1915-28 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Reverse transcriptase |
---|
Name: | Reverse transcriptase |
Synonyms: | n/a |
Type: | Protein |
Mol. Mass.: | 29598.37 |
Organism: | Human immunodeficiency virus 1 |
Description: | Q9WKE8 |
Residue: | 254 |
Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
BDBM50076169 |
---|
n/a |
---|
Name | BDBM50076169 |
Synonyms: | CHEMBL3415853 |
Type | Small organic molecule |
Emp. Form. | C21H16FNO4 |
Mol. Mass. | 365.3544 |
SMILES | OC(=O)C(\O)=C\C(=O)c1cc(cn1Cc1ccc(F)cc1)-c1ccccc1 |
Structure |
|