| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Reverse transcriptase |
|---|
| Ligand | BDBM50076169 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1473838 (CHEMBL3418915) |
|---|
| IC50 | 14000±n/a nM |
|---|
| Citation |  Cuzzucoli Crucitti, G; Métifiot, M; Pescatori, L; Messore, A; Madia, VN; Pupo, G; Saccoliti, F; Scipione, L; Tortorella, S; Esposito, F; Corona, A; Cadeddu, M; Marchand, C; Pommier, Y; Tramontano, E; Costi, R; Di Santo, R Structure-activity relationship of pyrrolyl diketo acid derivatives as dual inhibitors of HIV-1 integrase and reverse transcriptase ribonuclease H domain. J Med Chem58:1915-28 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Reverse transcriptase |
|---|
| Name: | Reverse transcriptase |
|---|
| Synonyms: | n/a |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 29598.37 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | Q9WKE8 |
|---|
| Residue: | 254 |
|---|
| Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
|---|
| BDBM50076169 |
|---|
| n/a |
|---|
| Name | BDBM50076169 |
|---|
| Synonyms: | CHEMBL3415853 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H16FNO4 |
|---|
| Mol. Mass. | 365.3544 |
|---|
| SMILES | OC(=O)C(\O)=C\C(=O)c1cc(cn1Cc1ccc(F)cc1)-c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
