| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Apoptosis regulator Bcl-2 |
|---|
| Ligand | BDBM50078030 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1471767 (CHEMBL3417878) |
|---|
| Ki | 1900±n/a nM |
|---|
| Citation |  Stornaiuolo, M; La Regina, G; Passacantilli, S; Grassia, G; Coluccia, A; La Pietra, V; Giustiniano, M; Cassese, H; Di Maro, S; Brancaccio, D; Taliani, S; Ialenti, A; Silvestri, R; Martini, C; Novellino, E; Marinelli, L Structure-based lead optimization and biological evaluation of BAX direct activators as novel potential anticancer agents. J Med Chem58:2135-48 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Apoptosis regulator Bcl-2 |
|---|
| Name: | Apoptosis regulator Bcl-2 |
|---|
| Synonyms: | Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | BCL2 | BCL2_HUMAN | Bcl-2 Protein |
|---|
| Type: | Homodimer or heterodimer |
|---|
| Mol. Mass.: | 26269.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P10415 |
|---|
| Residue: | 239 |
|---|
| Sequence: | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
|
|
|
|---|
| BDBM50078030 |
|---|
| n/a |
|---|
| Name | BDBM50078030 |
|---|
| Synonyms: | CHEMBL3417410 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H15N3OS |
|---|
| Mol. Mass. | 345.418 |
|---|
| SMILES | CC1=NN(C(=O)\C1=C\c1ccccc1)c1nc(cs1)-c1ccccc1 |t:1| |
|---|
| Structure | 
|
|---|
Search and Browse
