Reaction Details |
| Report a problem with these data |
Target | DNA-3-methyladenine glycosylase |
---|
Ligand | BDBM67690 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1463504 (CHEMBL3398686) |
---|
IC50 | 2500±n/a nM |
---|
Citation | Dixon, M; Woodrick, J; Gupta, S; Karmahapatra, SK; Devito, S; Vasudevan, S; Dakshanamurthy, S; Adhikari, S; Yenugonda, VM; Roy, R Naturally occurring polyphenol, morin hydrate, inhibits enzymatic activity of N-methylpurine DNA glycosylase, a DNA repair enzyme with various roles in human disease. Bioorg Med Chem23:1102-11 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
DNA-3-methyladenine glycosylase |
---|
Name: | DNA-3-methyladenine glycosylase |
Synonyms: | 3-alkyladenine DNA glycosylase | 3-methyladenine DNA glycosidase | 3MG_HUMAN | AAG | ADPG | ANPG | MID1 | MPG | N-methylpurine-DNA glycosylase |
Type: | PROTEIN |
Mol. Mass.: | 32883.92 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_109564 |
Residue: | 298 |
Sequence: | MVTPALQMKKPKQFCRRMGQKKQRPARAGQPHSSSDAAQAPAEQPHSSSDAAQAPCPRER
CLGPPTTPGPYRSIYFSSPKGHLTRLGLEFFDQPAVPLARAFLGQVLVRRLPNGTELRGR
IVETEAYLGPEDEAAHSRGGRQTPRNRGMFMKPGTLYVYIIYGMYFCMNISSQGDGACVL
LRALEPLEGLETMRQLRSTLRKGTASRVLKDRELCSGPSKLCQALAINKSFDQRDLAQDE
AVWLERGPLEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA
|
|
|
BDBM67690 |
---|
n/a |
---|
Name | BDBM67690 |
Synonyms: | 1,4-bis[2-(2-hydroxyethylamino)ethylamino]-5,8-bis(oxidanyl)anthracene-9,10-dione;hydrochloride | 1,4-dihydroxy-5,8-bis[2-(2-hydroxyethylamino)ethylamino]-9,10-anthraquinone;hydrochloride | 1,4-dihydroxy-5,8-bis[2-(2-hydroxyethylamino)ethylamino]anthracene-9,10-dione;hydrochloride | DHAD | MITOXANTRONE | MITOXANTRONE DIHYDROCHLORIDE | MLS001333711 | SMR000058480 | cid_4212 | cid_5458171 |
Type | Small organic molecule |
Emp. Form. | C22H28N4O6 |
Mol. Mass. | 444.4809 |
SMILES | OCCNCCNc1ccc(NCCNCCO)c2C(=O)c3c(O)ccc(O)c3C(=O)c12 |
Structure |
|