Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 9A
LigandBDBM50150239
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1556451
Ki 50000±n/a nM
Citation Li PZheng HZhao JZhang LYao WZhu HBeard JDIda KLane WSnell GSogabe SHeyser CJSnyder GLHendrick JPVanover KEDavis REWennogle LP Discovery of Potent and Selective Inhibitors of Phosphodiesterase 1 for the Treatment of Cognitive Impairment Associated with Neurodegenerative and Neuropsychiatric Diseases. J Med Chem 59:1149-64 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 9A
Name:3',5'-cyclic phosphodiesterase
Synonyms:High affinity cGMP-specific 3'',5''-cyclic phosphodiesterase 9A | Phosphodiesterase 9A (PDE9) | Phosphodiesterase 9A (PDE9A)
Type:Protein
Mol. Mass.:68488.40
Organism:Homo sapiens (Human)
Description:O76083
Residue:593
Sequence:
MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLPRNTTISLLTTDDAM
VSIDPTMPANSERTPYKVRPVAIKQLSAGVEDKRTTSRGQSAERPLRDRRVVGLEQPRRE
GAFESGQVEPRPREPQGCYQEGQRIPPEREELIQSVLAQVAEQFSRAFKINELKAEVANH
LAVLEKRVELEGLKVVEIEKCKSDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDV
PTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLF
CVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYN
NTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLI
LATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCL
LEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIML
QPLWESRDRYEELKRIDDAMKELQKKTDSLTSGATEKSRERSRDVKNSEGDCA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50150239
n/a
NameBDBM50150239
Synonyms:CHEMBL3769461
TypeSmall organic molecule
Emp. Form.C25H23F3N6O
Mol. Mass.480.4849
SMILES[H][C@@]12CCC[C@]1([H])N1C(=N2)N(C)C(=O)c2c(Nc3ccccc3)n(Cc3ccc(cc3)C(F)(F)F)nc12 |r,c:9|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: