Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysine-specific demethylase 4B
LigandBDBM50151921
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1561970
IC50 41±n/a nM
Citation Bavetsias VLanigan RMRuda GFAtrash BMcLaughlin MGTumber AMok NYLe Bihan YVDempster SBoxall KJJeganathan FHatch SBSavitsky PVelupillai SKrojer TEngland KSSejberg JThai CDonovan APal AScozzafava GBennett JMKawamura AJohansson CSzykowska AGileadi CBurgess-Brown NAvon Delft FOppermann UWalters ZShipley JRaynaud FIWestaway SMPrinjha RKFedorov OBurke RSchofield CJWestwood IMBountra CMüller Svan Montfort RLBrennan PEBlagg J 8-Substituted Pyrido[3,4-d]pyrimidin-4(3H)-one Derivatives As Potent, Cell Permeable, KDM4 (JMJD2) and KDM5 (JARID1) Histone Lysine Demethylase Inhibitors. J Med Chem 59:1388-409 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Lysine-specific demethylase 4B
Name:Lysine-specific demethylase 4B
Synonyms:JHDM3B | JMJD2B | JmjC domain-containing histone demethylation protein 3B | Jumonji domain-containing protein 2B | KDM4B | KIAA0876
Type:PROTEIN
Mol. Mass.:121904.33
Organism:Homo sapiens (Human)
Description:ChEMBL_109446
Residue:1096
Sequence:
MGSEDHGAQNPSCKIMTFRPTMEEFKDFNKYVAYIESQGAHRAGLAKIIPPKEWKPRQTY
DDIDDVVIPAPIQQVVTGQSGLFTQYNIQKKAMTVGEYRRLANSEKYCTPRHQDFDDLER
KYWKNLTFVSPIYGADISGSLYDDDVAQWNIGSLRTILDMVERECGTIIEGVNTPYLYFG
MWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAIGFFPGSSQGCDAFLR
HKMTLISPIILKKYGIPFSRITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATLRWIDY
GKVATQCTCRKDMVKISMDVFVRILQPERYELWKQGKDLTVLDHTRPTALTSPELSSWSA
SRASLKAKLLRRSHRKRSQPKKPKPEDPKFPGEGTAGAALLEEAGGSVKEEAGPEVDPEE
EEEEPQPLPHGREAEGAEEDGRGKLRPTKAKSERKKKSFGLLPPQLPPPPAHFPSEEALW
LPSPLEPPVLGPGPAAMEESPLPAPLNVVPPEVPSEELEAKPRPIIPMLYVVPRPGKAAF
NQEHVSCQQAFEHFAQKGPTWKEPVSPMELTGPEDGAASSGAGRMETKARAGEGQAPSTF
SKLKMEIKKSRRHPLGRPPTRSPLSVVKQEASSDEEASPFSGEEDVSDPDALRPLLSLQW
KNRAASFQAERKFNAAAARTEPYCAICTLFYPYCQALQTEKEAPIASLGKGCPATLPSKS
RQKTRPLIPEMCFTSGGENTEPLPANSYIGDDGTSPLIACGKCCLQVHASCYGIRPELVN
EGWTCSRCAAHAWTAECCLCNLRGGALQMTTDRRWIHVICAIAVPEARFLNVIERHPVDI
SAIPEQRWKLKCVYCRKRMKKVSGACIQCSYEHCSTSFHVTCAHAAGVLMEPDDWPYVVS
ITCLKHKSGGHAVQLLRAVSLGQVVITKNRNGLYYRCRVIGAASQTCYEVNFDDGSYSDN
LYPESITSRDCVQLGPPSEGELVELRWTDGNLYKAKFISSVTSHIYQVEFEDGSQLTVKR
GDIFTLEEELPKRVRSRLSLSTGAPQEPAFSGEEAKAAKRPRVGTPLATEDSGRSQDYVA
FVESLLQVQGRPGAPF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50151921
n/a
NameBDBM50151921
Synonyms:CHEMBL3774456
TypeSmall organic molecule
Emp. Form.C23H22F2N6O
Mol. Mass.436.4572
SMILESFc1cc(F)cc(c1)C1CCN(CCc2cnn(c2)-c2nccc3c2nc[nH]c3=O)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: