Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone-arginine methyltransferase CARM1
LigandBDBM50158097
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1564308
IC50 200±n/a nM
Citation Ferreira de Freitas REram MSSzewczyk MMSteuber HSmil DWu HLi FSenisterra GDong ABrown PJHitchcock MMoosmayer DStegmann CMEgner UArrowsmith CBarsyte-Lovejoy DVedadi MSchapira M Discovery of a Potent Class I Protein Arginine Methyltransferase Fragment Inhibitor. J Med Chem 59:1176-83 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Histone-arginine methyltransferase CARM1
Name:Histone-arginine methyltransferase CARM1
Synonyms:CARM1 | Coactivator-associated arginine methyltransferase 1 | Coactivator-associated arginine methyltransferase 1 (CARM1) | Protein arginine N-methyltransferase 4 | Protein arginine methyltransferase 4 (PRMT4)
Type:Protein
Mol. Mass.:65855.47
Organism:Homo sapiens (Human)
Description:n/a
Residue:608
Sequence:
MAAAAAAVGPGAGGAGSAVPGGAGPCATVSVFPGARLLTIGDANGEIQRHAEQQALRLEV
RAGPDSAGIALYSHEDVCVFKCSVSRETECSRVGKQSFIITLGCNSVLIQFATPNDFCSF
YNILKTCRGHTLERSVFSERTEESSAVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNH
TDFKDKIVLDVGCGSGILSFFAAQAGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPG
KVEEVSLPEQVDIIISEPMGYMLFNERMLESYLHAKKYLKPSGNMFPTIGDVHLAPFTDE
QLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFL
EAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRC
LFQSPLFAKAGDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFRYTGTT
PSPPPGSHYTSPSENMWNTGSTYNLSSGMAVAGMPTAYDLSSVIASGSSVGHNNLIPLAN
TGIVNHTHSRMGSIMSTGIVQGSSGAQGSGGGSTSAHYAVNSQFTMGGPAISMASPMSIP
TNTMHYGS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50158097
n/a
NameBDBM50158097
Synonyms:CHEMBL3780701
TypeSmall organic molecule
Emp. Form.C9H20N2
Mol. Mass.156.2685
SMILESCNCCN1CCC(C)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: