Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProgesterone receptor
LigandBDBM50169542
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1578398
IC50 2300±n/a nM
Citation Yang FSnyder LBBalakrishnan ABrown JMSivarao DVEaston AFernandes AGulianello MHanumegowda UMHuang HHuang YJones KMLi YWMatchett MMattson GMiller RSantone KSSenapati AShields EESimutis FJWestphal RWhiterock VJBronson JJMacor JEDegnan AP Discovery and Preclinical Evaluation of BMS-955829, a Potent Positive Allosteric Modulator of mGluR5. ACS Med Chem Lett 7:289-93 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Progesterone receptor
Name:Progesterone receptor
Synonyms:Nuclear receptor subfamily 3 group C member 3 | PR | progesterone
Type:Protein
Mol. Mass.:98979.52
Organism:Homo sapiens (Human)
Description:P06401
Residue:933
Sequence:
MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLF
PRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGLLDSVLDTLLA
PSGPGQSQPSPPACEVTSSWCLFGPELPEDPPAAPATQRVLSPLMSRSGCKVGDSSGTAA
AHKVLPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVEVEEEDGSESEESAGPLLKGK
PRALGGAAAGGGAAAVPPGAAAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLATTV
MDFIHVPILPLNHALLAARTRQLLEDESYDGGAGAASAFAPPRSSPCASSTPVAVGDFPD
CAYPPDAEPKDDAYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPLG
PPPPLPPRATPSRPGEAAVTAAPASASVSSASSSGSTLECILYKAEGAPPQQGPFAPPPC
KAPGASGCLLPRDGLPSTSASAAAAGAAPALYPALGLNGLPQLGYQAAVLKEGLPQVYPP
YLNYLRPDSEASQSPQYSFESLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHN
YLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVVRALDAVALPQPV
GVPNESQALSQRFTFSPGQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQ
LGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAP
DLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQ
FEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRA
LSVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50169542
n/a
NameBDBM50169542
Synonyms:CHEMBL3804846
TypeSmall organic molecule
Emp. Form.C22H14F2N2O2
Mol. Mass.376.3556
SMILESFc1ccc(F)c(c1)[C@H]1OC(=O)N[C@@H]1c1cncc(c1)C#Cc1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: