Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIsoprenylcysteine carboxyl methyltransferase
LigandBDBM50183445
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1586735
IC50 7700±n/a nM
Citation Butler KVBohn KHrycyna CAJin J Non-Substrate Based, Small Molecule Inhibitors of the Human Isoprenylcysteine Carboxyl Methyltransferase. Medchemcomm 7:1016-1021 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Isoprenylcysteine carboxyl methyltransferase
Name:Isoprenylcysteine carboxyl methyltransferase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:31943.26
Organism:Homo sapiens (Human)
Description:ChEMBL_956034
Residue:284
Sequence:
MAGCAARAPPGSEARLSLATFLLGASVLALPLLTRAGLQGRTGLALYVAGLNALLLLLYR
PPRYQIAIRACFLGFVFGCGTLLSFSQSSWSHFGWYMCSLSLFHYSEYLVTAVNNPKSLS
LDSFLLNHSLEYTVAALSSWLEFTLENIFWPELKQITWLSVTGLLMVVFGECLRKAAMFT
AGSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFYWSIGTQVMLCNPICGVSYALTV
WRFFRDRTEEEEISLIHFFGEEYLEYKKRVPTGLPFIKGVKVDL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50183445
n/a
NameBDBM50183445
Synonyms:CHEMBL3822621
TypeSmall organic molecule
Emp. Form.C20H18O2S
Mol. Mass.322.421
SMILES[#8]-c1c(ccc2ccccc12)-[#6](\c1cccs1)=[#6]-1/[#6]-[#6]-[#8]-[#6]-[#6]-1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: