Reaction Details |
| Report a problem with these data |
Target | Adenosine receptor A1 |
---|
Ligand | BDBM50199724 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1621693 (CHEMBL3863976) |
---|
IC50 | 81±n/a nM |
---|
Citation | Grŕcia, J; Buil, MA; Castro, J; Eichhorn, P; Ferrer, M; Gavaldŕ, A; Hernández, B; Segarra, V; Lehner, MD; Moreno, I; Pagčs, L; Roberts, RS; Serrat, J; Sevilla, S; Taltavull, J; Andrés, M; Cabedo, J; Vilella, D; Calama, E; Carcasona, C; Miralpeix, M Biphenyl Pyridazinone Derivatives as Inhaled PDE4 Inhibitors: Structural Biology and Structure-Activity Relationships. J Med Chem59:10479-10497 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Adenosine receptor A1 |
---|
Name: | Adenosine receptor A1 |
Synonyms: | A1 adenosine receptor (hA1) | A1AR | AA1R_HUMAN | ADENOSINE A1 | ADORA1 | Adenosine A1 receptor (A1AR) | Adenosine A1-receptor | Adenosine receptor A1 (A1) | Adenosine receptor A1 (hA1) | Adenosine transporter (AdT) |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 36520.92 |
Organism: | Homo sapiens (Human) |
Description: | P30542 |
Residue: | 326 |
Sequence: | MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD
|
|
|
BDBM50199724 |
---|
n/a |
---|
Name | BDBM50199724 |
Synonyms: | CHEMBL3903408 |
Type | Small organic molecule |
Emp. Form. | C36H39Cl2N7O4 |
Mol. Mass. | 704.645 |
SMILES | CCn1nc(cc(NC(=O)Nc2c(Cl)cncc2Cl)c1=O)-c1cccc(c1)-c1cc(OCC2CC2)cc(c1)C(=O)NCCN1CCCCC1 |
Structure |
|