Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeripheral-Type Benzodiazepine Receptor
LigandBDBM50210940
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1635890
Ki 23±n/a nM
Citation Kim TYang HYPark BGJung SYPark JHPark KDMin SJTae JYang HCho SCho SJSong HMook-Jung ILee JPae AN Discovery of benzimidazole derivatives as modulators of mitochondrial function: A potential treatment for Alzheimer's disease. Eur J Med Chem 125:1172-1192 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peripheral-Type Benzodiazepine Receptor
Name:Benzodiazepine receptors; peripheral & central
Synonyms:Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR)
Type:Mitochondrion membrane protein
Mol. Mass.:18945.84
Organism:Rattus norvegicus (rat)
Description:Competitive binding experiments were performed on rat kidney mitochondrial membranes.
Residue:169
Sequence:
MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50210940
n/a
NameBDBM50210940
Synonyms:CHEMBL3948914
TypeSmall organic molecule
Emp. Form.C26H25Cl2N3O
Mol. Mass.466.402
SMILESCC(C)c1ccc(C)c(NC(=O)Cn2c(Cc3c(Cl)cccc3Cl)nc3ccccc23)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: