| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50210940 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1635890 (CHEMBL3878788) |
|---|
| IC50 | 74±n/a nM |
|---|
| Citation |  Kim, T; Yang, HY; Park, BG; Jung, SY; Park, JH; Park, KD; Min, SJ; Tae, J; Yang, H; Cho, S; Cho, SJ; Song, H; Mook-Jung, I; Lee, J; Pae, AN Discovery of benzimidazole derivatives as modulators of mitochondrial function: A potential treatment for Alzheimer's disease. Eur J Med Chem125:1172-1192 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
|---|
| Type: | Mitochondrion membrane protein |
|---|
| Mol. Mass.: | 18945.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
|---|
| Residue: | 169 |
|---|
| Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
|---|
| BDBM50210940 |
|---|
| n/a |
|---|
| Name | BDBM50210940 |
|---|
| Synonyms: | CHEMBL3948914 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H25Cl2N3O |
|---|
| Mol. Mass. | 466.402 |
|---|
| SMILES | CC(C)c1ccc(C)c(NC(=O)Cn2c(Cc3c(Cl)cccc3Cl)nc3ccccc23)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
