Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50210940 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1635891 (CHEMBL3878789) |
---|
Kd | 108±n/a nM |
---|
Citation | Kim, T; Yang, HY; Park, BG; Jung, SY; Park, JH; Park, KD; Min, SJ; Tae, J; Yang, H; Cho, S; Cho, SJ; Song, H; Mook-Jung, I; Lee, J; Pae, AN Discovery of benzimidazole derivatives as modulators of mitochondrial function: A potential treatment for Alzheimer's disease. Eur J Med Chem125:1172-1192 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | BZRP | MBR | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor-related protein | Peripheral-type benzodiazepine receptor | TSPO | TSPO_HUMAN |
Type: | Enzyme |
Mol. Mass.: | 18834.74 |
Organism: | Homo sapiens (Human) |
Description: | P30536 |
Residue: | 169 |
Sequence: | MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
|
|
|
BDBM50210940 |
---|
n/a |
---|
Name | BDBM50210940 |
Synonyms: | CHEMBL3948914 |
Type | Small organic molecule |
Emp. Form. | C26H25Cl2N3O |
Mol. Mass. | 466.402 |
SMILES | CC(C)c1ccc(C)c(NC(=O)Cn2c(Cc3c(Cl)cccc3Cl)nc3ccccc23)c1 |
Structure |
|