Reaction Details |
| Report a problem with these data |
Target | BCR/ABL p210 fusion protein |
---|
Ligand | BDBM50211223 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1636131 (CHEMBL3879029) |
---|
EC50 | <100±n/a nM |
---|
Citation | Wang, Q; Liu, F; Wang, B; Zou, F; Qi, Z; Chen, C; Yu, K; Hu, C; Qi, S; Wang, W; Hu, Z; Liu, J; Wang, W; Wang, L; Liang, Q; Zhang, S; Ren, T; Liu, Q; Liu, J Discovery of 4-Methyl-N-(4-((4-methylpiperazin-1-yl)methyl)-3-(trifluoromethyl)phenyl)-3-((1-nicotinoylpiperidin-4-yl)oxy)benzamide (CHMFL-ABL/KIT-155) as a Novel Highly Potent Type II ABL/KIT Dual Kinase Inhibitor with a Distinct Hinge Binding. J Med Chem60:273-289 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
BCR/ABL p210 fusion protein |
---|
Name: | BCR/ABL p210 fusion protein |
Synonyms: | BCR/ABL | BCR/ABL p210 fusion protein | fusion |
Type: | PROTEIN |
Mol. Mass.: | 10728.88 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_102433 |
Residue: | 97 |
Sequence: | QMLTNSCVKLQTVHSIPLTINKEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDP
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWC
|
|
|
BDBM50211223 |
---|
n/a |
---|
Name | BDBM50211223 |
Synonyms: | CHEMBL3939150 |
Type | Small organic molecule |
Emp. Form. | C33H38F3N5O3 |
Mol. Mass. | 609.6817 |
SMILES | CN1CCN(Cc2ccc(cc2C(F)(F)F)C(=O)Nc2ccc(C)c(OC3CCN(CC3)C(=O)c3ccc(C)nc3)c2)CC1 |
Structure |
|