| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Similar to alpha-tubulin isoform 1 |
|---|
| Ligand | BDBM50230756 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_211322 (CHEMBL818981) |
|---|
| IC50 | >100000±n/a nM |
|---|
| Citation |  Terada, T; Fujimoto, K; Nomura, M; Yamashita, J; Wierzba, K; Yamazaki, R; Shibata, J; Sugimoto, Y; Yamada, Y; Kobunai, T Antitumor agents. 3. Synthesis and biological activity of 4 beta-alkyl derivatives containing hydroxy, amino, and amido groups of 4'-O-demethyl-4-desoxypodophyllotoxin as antitumor agents. J Med Chem36:1689-99 (1993) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Similar to alpha-tubulin isoform 1 |
|---|
| Name: | Similar to alpha-tubulin isoform 1 |
|---|
| Synonyms: | Similar to alpha-tubulin isoform 1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 10383.05 |
|---|
| Organism: | Bos taurus |
|---|
| Description: | ChEMBL_104716 |
|---|
| Residue: | 99 |
|---|
| Sequence: | CVSASPSTLARLVSRSAMPAGSSTAWNTAFSPMARCQVTKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRSSSTLSSSSQAKKMP
|
|
|
|---|
| BDBM50230756 |
|---|
| n/a |
|---|
| Name | BDBM50230756 |
|---|
| Synonyms: | CHEMBL1202598 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H40Cl2N2O7 |
|---|
| Mol. Mass. | 599.543 |
|---|
| SMILES | Cl.Cl.[H][C@@]12C(COC1=O)[C@H](CCN(C)CCCN(C)C)c1cc3OCOc3cc1[C@H]2c1cc(OC)c(O)c(OC)c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
