Reaction Details |
| Report a problem with these data |
Target | Cyclin-dependent kinase 1 |
---|
Ligand | BDBM206104 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1654862 (CHEMBL4004228) |
---|
IC50 | >50000±n/a nM |
---|
Citation | Miura, T; Matsuo, A; Muraoka, T; Ide, M; Morikami, K; Kamikawa, T; Nishihara, M; Kashiwagi, H Identification of a selective inhibitor of transforming growth factorß-activated kinase 1 by biosensor-based screening of focused libraries. Bioorg Med Chem Lett27:1031-1036 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cyclin-dependent kinase 1 |
---|
Name: | Cyclin-dependent kinase 1 |
Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
Type: | Enzyme Subunit |
Mol. Mass.: | 34101.08 |
Organism: | Homo sapiens (Human) |
Description: | P06493 |
Residue: | 297 |
Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
BDBM206104 |
---|
n/a |
---|
Name | BDBM206104 |
Synonyms: | US9255110, 17 |
Type | Small organic molecule |
Emp. Form. | C17H12N4O2S |
Mol. Mass. | 336.368 |
SMILES | COc1cc2ncccc2cc1NC(=O)c1csc2cncnc12 |
Structure |
|