Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCAMK2A
LigandBDBM50235816
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1658078
IC50>10000±n/a nM
Citation Hoemann MWilson NArgiriadi MBanach DBurchat ACalderwood DClapham BCox PDuignan DBKonopacki DSomal GVasudevan A Synthesis and optimization of furano[3,2-d]pyrimidines as selective spleen tyrosine kinase (Syk) inhibitors. Bioorg Med Chem Lett 26:5562-5567 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
CAMK2A
Name:CAMK2A
Synonyms:CaM kinase II | CaM kinase II alpha | Calcium/calmodulin-dependent protein kinase type II subunit alpha (CAMK2a)
Type:Enzyme Catalytic Domain
Mol. Mass.:54093.63
Organism:Homo sapiens (Human)
Description:gi_25952118
Residue:478
Sequence:
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKSDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEA
ISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHIH
LMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSVLPH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50235816
n/a
NameBDBM50235816
Synonyms:CHEMBL4069365
TypeSmall organic molecule
Emp. Form.C19H18F3N5O3
Mol. Mass.421.3731
SMILESCC1(C)OCC(=O)Nc2cc(Nc3nc(NCC(F)(F)F)c4occc4n3)ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: