| Reaction Details |
|---|
 | Report a problem with these data |
| Target | D(3) dopamine receptor |
|---|
| Ligand | BDBM50236335 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1659126 (CHEMBL4008738) |
|---|
| EC50 | 37±n/a nM |
|---|
| Citation |  De Simone, A; Russo, D; Ruda, GF; Micoli, A; Ferraro, M; Di Martino, RM; Ottonello, G; Summa, M; Armirotti, A; Bandiera, T; Cavalli, A; Bottegoni, G Design, Synthesis, Structure-Activity Relationship Studies, and Three-Dimensional Quantitative Structure-Activity Relationship (3D-QSAR) Modeling of a Series of O-Biphenyl Carbamates as Dual Modulators of Dopamine D3 Receptor and Fatty Acid Amide Hydrolase. J Med Chem60:2287-2304 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| D(3) dopamine receptor |
|---|
| Name: | D(3) dopamine receptor |
|---|
| Synonyms: | DOPAMINE D3 | DRD3 | DRD3_HUMAN | Dopamine D3 receptor | Dopamine D3 receptor (D3) | Dopamine D3 receptor (D3R) | Dopamine receptor | Dopamine receptor (D3) | Dopamine receptor D3 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 44243.43 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 400 |
|---|
| Sequence: | MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
|
|
|
|---|
| BDBM50236335 |
|---|
| n/a |
|---|
| Name | BDBM50236335 |
|---|
| Synonyms: | CHEMBL4090459 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H35N3O4 |
|---|
| Mol. Mass. | 489.6059 |
|---|
| SMILES | COc1ccccc1N1CCN(CCCCNC(=O)Oc2ccc(c(OC)c2)-c2ccccc2)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
