Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 14
LigandBDBM84796
Substrate/CompetitorMAP kinase-activated protein kinase 2
Meas. Tech.Active p38alpha cascade assay
pH7.5±0
Temperature298.15±0 K
IC50 1.8±0.0 nM
Citation Tecle HFeru FLiu HKuhn CRennie GMorris MShao JCheng ACGikunju DMiret JColi RXi SHClugston SLLow SKazmirski SDing YHCao QJohnson TLDeshmukh GDDiNitto JPWu JCEnglish JM The design, synthesis and potential utility of fluorescence probes that target DFG-out conformation of p38alpha for high throughput screening binding assay. Chem Biol Drug Des 74:547-59 (2009) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Mitogen-activated protein kinase 14
Name:Mitogen-activated protein kinase 14
Synonyms:CSAID-binding protein | CSBP | Cytokine suppressive anti-inflammatory drug-binding protein | MAP Kinase p38 alpha | MAP kinase MXI2 | MAP kinase p38 | MAX-interacting protein 2 | Mitogen-activated protein kinase (MAP) p38 alpha | Mitogen-activated protein kinase (Map p38 alpha) | Mitogen-activated protein kinase 14 (MAP kinase p38 alpha) | Mitogen-activated protein kinase 14 (MAPK14 p38 alpha) | Mitogen-activated protein kinase 14 (MAPK14) | Mitogen-activated protein kinase 14 (MAPK14) (p38 MAPKa) | Mitogen-activated protein kinase 14 (MAPK14) (p38 MAPKÿ±) | Mitogen-activated protein kinase 14 (p38 MAPKa) | Mitogen-activated protein kinase 14 (p38 alpha) | Mitogen-activated protein kinase 14, activated protein kinase p38 alpha | Mitogen-activated protein kinase p38 alpha | Mitogen-activated protein kinase p38 alpha (p38 MAPKa) | SAPK2A | p38-alpha
Type:Serine/threonine-protein kinase
Mol. Mass.:41286.76
Organism:Homo sapiens (Human)
Description:n/a
Residue:360
Sequence:
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM84796
MAP kinase-activated protein kinase 2
Name:MAP kinase-activated protein kinase 2
Synonyms:MAP kinase-activated protein kinase 2 (MAPKAPK2) | MAP kinase-activated protein kinase 2 (MK2) | MAP kinase-activated protein kinase 2 (p38/MK2) | MAPK-Activated Protein Kinase 2 (MK2) | MAPK-activated protein kinase 2 | MAPKAP kinase 2 | MAPKAPK-2 | MAPKAPK2 | MK2
Type:Serine/threonine-protein kinase
Mol. Mass.:45579.87
Organism:Homo sapiens (Human)
Description:P49137
Residue:400
Sequence:
MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAII
DDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRI
VDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSI
NIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKY
DKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKM
LIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSAL
ATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff: