Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukotriene 2
LigandBDBM50013889
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_1103
Citation Heise CEO'Dowd BFFigueroa DJSawyer NNguyen TIm DSStocco RBellefeuille JNAbramovitz MCheng RWilliams DLZeng ZLiu QMa LClements MKCoulombe NLiu YAustin CPGeorge SRO'Neill GPMetters KMLynch KREvans JF Characterization of the human cysteinyl leukotriene 2 receptor. J Biol Chem 275:30531-6 (2000) [PubMed]  Article
More Info.:Get all data from this article
 
Leukotriene 2
Name:Leukotriene B4 receptor
Synonyms:LTB4 receptor JULF2 | LTB4-R2 | LTB4R2 | LTB4R2 protein | Leukotriene B4 | Leukotriene B4 R2 | Leukotriene B4 receptor 2 | Leukotriene B4 receptor BLT2 | Leukotriene b1 | Seven transmembrane receptor BLTR2
Type:Enzyme Catalytic Domain
Mol. Mass.:41553.59
Organism:Homo sapiens (Human)
Description:Leukotriene 2 0 HUMAN::Q9NPC1
Residue:389
Sequence:
MAPSHRASQVGFCPTPERPLWRLPPTCRPRRMSVCYRPPGNETLLSWKTSRATGTAFLLL
AALLGLPGNGFVVWSLAGWRPARGRPLAATLVLHLALADGAVLLLTPLFVAFLTRQAWPL
GQAGCKAVYYVCALSMYASVLLTGLLSLQRCLAVTRPFLAPRLRSPALARRLLLAVWLAA
LLLAVPAAVYRHLWRDRVCQLCHPSPVHAAAHLSLETLTAFVLPFGLMLGCYSVTLARLR
GARWGSGRHGARVGRLVSAIVLAFGLLWAPYHAVNLLQAVAALAPPEGALAKLGGAGQAA
RAGTTALAFFSSSVNPVLYVFTAGDLLPRAGPRFLTRLFEGSGEARGGGRSREGTMELRT
TPQLKVVGQGRGNGDPGGGMEKDGPEWDL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50013889
n/a
NameBDBM50013889
Synonyms:(5S,6Z,8E,10E,12R,14Z)-5,12-dihydroxyicosa-6,8,10,14-tetraenoic acid | (S-(R*,S*-(E,Z,E,Z)))-5,12-Dihydroxy-6,8,10,14-eicosatetraenoic acid | 5,12-Dihete | 5,12-Hete | 5S,12R-dihydroxy-6Z,8E,10E,14Z-eicosatetraenoic acid | CHEMBL65061 | DIHETE 12(s), 5(s) | LTB4 | leukotriene B4
TypeSmall organic molecule
Emp. Form.C20H32O4
Mol. Mass.336.4657
SMILESCCCCC\C=C/C[C@@H](O)\C=C\C=C\C=C/[C@@H](O)CCCC(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: