| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Leukotriene B4 receptor 2 |
|---|
| Ligand | BDBM50297387 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 693±n/a nM |
|---|
| Comments | PDSP_1117 |
|---|
| Citation |  Heise, CE; O'Dowd, BF; Figueroa, DJ; Sawyer, N; Nguyen, T; Im, DS; Stocco, R; Bellefeuille, JN; Abramovitz, M; Cheng, R; Williams, DL; Zeng, Z; Liu, Q; Ma, L; Clements, MK; Coulombe, N; Liu, Y; Austin, CP; George, SR; O'Neill, GP; Metters, KM; Lynch, KR; Evans, JF Characterization of the human cysteinyl leukotriene 2 receptor. J Biol Chem275:30531-6 (2000) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Leukotriene B4 receptor 2 |
|---|
| Name: | Leukotriene B4 receptor 2 |
|---|
| Synonyms: | BLT2R | BLTR2 | LT4R2_HUMAN | LTB4 receptor JULF2 | LTB4-R 2 | LTB4-R2 | LTB4R2 | LTB4R2 protein | Leukotriene B4 | Leukotriene B4 R2 | Leukotriene B4 receptor | Leukotriene B4 receptor 2 | Leukotriene B4 receptor BLT2 | Leukotriene b1 | Seven transmembrane receptor BLTR2 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 37964.86 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Leukotriene 2 0 HUMAN::Q9NPC1 |
|---|
| Residue: | 358 |
|---|
| Sequence: | MSVCYRPPGNETLLSWKTSRATGTAFLLLAALLGLPGNGFVVWSLAGWRPARGRPLAATL
VLHLALADGAVLLLTPLFVAFLTRQAWPLGQAGCKAVYYVCALSMYASVLLTGLLSLQRC
LAVTRPFLAPRLRSPALARRLLLAVWLAALLLAVPAAVYRHLWRDRVCQLCHPSPVHAAA
HLSLETLTAFVLPFGLMLGCYSVTLARLRGARWGSGRHGARVGRLVSAIVLAFGLLWAPY
HAVNLLQAVAALAPPEGALAKLGGAGQAARAGTTALAFFSSSVNPVLYVFTAGDLLPRAG
PRFLTRLFEGSGEARGGGRSREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGPEWDL
|
|
|
|---|
| BDBM50297387 |
|---|
| n/a |
|---|
| Name | BDBM50297387 |
|---|
| Synonyms: | (5S,6R,7E,9E,11Z,14Z)-6-(cystein-S-yl)-5-hydroxyicosa-7,9,11,14-tetraenoic acidS-{(1R,2E,4E,6Z,9Z)-1-[(1S)-4-carboxy-1-hydroxybutyl]pentadeca-2,4,6,9-tetraen-1-yl}-L-cysteine | (5S-(5R*,6S*(S*),7E,9E,11Z,14Z))-6-((2-Amino-2-carboxyethyl)thio)-5-hydroxy-7,9,11,14-eicosatetraenoic acid | 5S-hydroxy,6R-(S-cysteinyl),7E,9E,11Z,14Z-eicosatetraenoic acid | CHEMBL509456 | LTE4 | leukotriene E4 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H37NO5S |
|---|
| Mol. Mass. | 439.609 |
|---|
| SMILES | CCCCC\C=C/C\C=C/C=C/C=C/[C@@H](SC[C@H](N)C(O)=O)[C@@H](O)CCCC(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
