Reaction Details |
| Report a problem with these data |
Target | Gamma-aminobutyric acid receptor subunit alpha-1 |
---|
Ligand | BDBM50000766 |
---|
Substrate/Competitor | n/a |
---|
Ki | 14±n/a nM |
---|
Comments | PDSP_656 |
---|
Citation | Griebel, G; Perrault, G; Simiand, J; Cohen, C; Granger, P; Decobert, M; Françon, D; Avenet, P; Depoortere, H; Tan, S; Oblin, A; Schoemaker, H; Evanno, Y; Sevrin, M; George, P; Scatton, B SL651498: an anxioselective compound with functional selectivity for alpha2- and alpha3-containing gamma-aminobutyric acid(A) (GABA(A)) receptors. J Pharmacol Exp Ther298:753-68 (2001) [PubMed] |
---|
More Info.: | Get all data from this article |
---|
|
Gamma-aminobutyric acid receptor subunit alpha-1 |
---|
Name: | Gamma-aminobutyric acid receptor subunit alpha-1 |
Synonyms: | Benzodiazepine central | Benzodiazepine receptors | GABA A Benzodiazepine | GABA A Benzodiazepine Type I | GABA A Benzodiazepine Type II | GABA A Benzodiazepine Type IIL | GABA A Benzodiazepine Type IIM | GABA A Benzodiazepine omega1 | GABA A Benzodiazepine omega2 | GABA A Benzodiazepine omega5 | GABA A alpha1 | GABA A anti-Alpha1 | GABA receptor alpha-1 subunit | GABA, Chloride, TBOB | GABA-PICROTOXIN | GBRA1_RAT | Gabra-1 | Gabra1 | TBPS |
Type: | Enzyme |
Mol. Mass.: | 51770.21 |
Organism: | Rattus norvegicus (Rat) |
Description: | P62813 |
Residue: | 455 |
Sequence: | MKKSRGLSDYLWAWTLILSTLSGRSYGQPSQDELKDNTTVFTRILDRLLDGYDNRLRPGL
GERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKI
WTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACP
LKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMT
THFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISAR
NSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDPL
IKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKIDR
LSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ
|
|
|
BDBM50000766 |
---|
n/a |
---|
Name | BDBM50000766 |
Synonyms: | CHEMBL12 | DIAZEPAM | US9271961, Diazepam |
Type | Small organic molecule |
Emp. Form. | C16H13ClN2O |
Mol. Mass. | 284.74 |
SMILES | CN1c2ccc(Cl)cc2C(=NCC1=O)c1ccccc1 |c:10| |
Structure |
|