Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetα-glucosidase
LigandBDBM108222
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay Against Commercial Glycosidases
pH10.6±n/a
Temperature310.15±n/a K
IC50 52± 0 nM
Commentsextracted
Citation Li ZLi TDai SXie XMa XZhao WZhang WLi JWang PG New insights into the pharmacological chaperone activity of c2-substituted glucoimidazoles for the treatment of Gaucher disease. Chembiochem 14:1239-47 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
α-glucosidase
Name:α-glucosidase
Synonyms:Alpha-glucosidase | Alpha-glucosidase (α-glucosidase) | Oligo-1,6-glucosidase
Type:Protein
Mol. Mass.:68577.59
Organism:Saccharomyces cerevisiae S288c (Baker's yeast)
Description:n/a
Residue:589
Sequence:
MTISSAHPETEPKWWKEATFYQIYPASFKDSNDDGWGDMKGIASKLEYIKELGADAIWIS
PFYDSPQDDMGYDIANYEKVWPTYGTNEDCFALIEKTHKLGMKFITDLVINHCSSEHEWF
KESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSYFGGSAWTFDEKTQEFYLRLFCS
TQPDLNWENEDCRKAIYESAVGYWLDHGVDGFRIDVGSLYSKVVGLPDAPVVDKNSTWQS
SDPYTLNGPRIHEFHQEMNQFIRNRVKDGREIMTVGEMQHASDETKRLYTSASRHELSEL
FNFSHTDVGTSPLFRYNLVPFELKDWKIALAELFRYINGTDCWSTIYLENHDQPRSITRF
GDDSPKNRVISGKLLSVLLSALTGTLYVYQGQELGQINFKNWPVEKYEDVEIRNNYNAIK
EEHGENSEEMKKFLEAIALISRDHARTPMQWSREEPNAGFSGPSAKPWFYLNDSFREGIN
VEDEIKDPNSVLNFWKEALKFRKAHKDITVYGYDFEFIDLDNKKLFSFTKKYNNKTLFAA
LNFSSDATDFKIPNDDSSFKLEFGNYPKKEVDASSRTLKPWEGRIYISE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM108222
n/a
NameBDBM108222
Synonyms:2-[3-(4-cyclohexylphenyl)propyl]-5-(hydroxymethyl)- 5H,6H,7H,8H-imidazo[1,2-a]pyridine-6,7,8-triol (Compound 8)
TypeSmall organic molecule
Emp. Form.C23H32N2O4
Mol. Mass.400.5112
SMILESOCC1C(O)C(O)C(O)c2nc(CCCc3ccc(cc3)C3CCCCC3)cn12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: