Reaction Details |
| Report a problem with these data |
Target | Chromobox protein homolog 7 |
---|
Ligand | BDBM154554 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | AlphaScreen Assay |
---|
pH | 8±0 |
---|
Temperature | 1663.9±0 K |
---|
IC50 | >1.00e+5±n/a nM |
---|
Citation | Perfetti, MT; Baughman, BM; Dickson, BM; Mu, Y; Cui, G; Mader, P; Dong, A; Norris, JL; Rothbart, SB; Strahl, BD; Brown, PJ; Janzen, WP; Arrowsmith, CH; Mer, G; McBride, KM; James, LI; Frye, SV Identification of a fragment-like small molecule ligand for the methyl-lysine binding protein, 53BP1. ACS Chem Biol10:1072-81 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Chromobox protein homolog 7 |
---|
Name: | Chromobox protein homolog 7 |
Synonyms: | CBX7 | CBX7_HUMAN | Chromobox protein homolog 7 | Chromobox protein homolog 7 (CBX7) |
Type: | Protein |
Mol. Mass.: | 28351.76 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 251 |
Sequence: | MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEK
EERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKA
GAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAP
DVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAA
EGFFRDRSGKF
|
|
|
BDBM154554 |
---|
n/a |
---|
Name | BDBM154554 |
Synonyms: | (3-Bromophenyl)(4-(tert-butyl)piperazin-1-yl)methanone (10) |
Type | Small organic molecule |
Emp. Form. | C15H21BrN2O |
Mol. Mass. | 325.244 |
SMILES | CC(C)(C)N1CCN(CC1)C(=O)c1cccc(Br)c1 |
Structure |
|